DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp61F and K07F5.6

DIOPT Version :9

Sequence 1:NP_476687.1 Gene:Ptp61F / 38160 FlyBaseID:FBgn0267487 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_501764.2 Gene:K07F5.6 / 177832 WormBaseID:WBGene00010634 Length:470 Species:Caenorhabditis elegans


Alignment Length:365 Identity:72/365 - (19%)
Similarity:127/365 - (34%) Gaps:120/365 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 EKQFSTSESERHTNRGLNRYRDVNPYDHSRIVLKRGSVD---------YINANLVQLERAERQYI 102
            ||..|.:.|:.|.   ||        |::|::|...:.:         ||||:.::.:.:::::|
 Worm   133 EKSLSKNRSKNHK---LN--------DNTRVILSPENTENSRTDPPDTYINASHIKFDNSQKEFI 186

  Fly   103 LTQGPLVDTVGHFWLMVWEQKSRAVLMLNKLMEKKQIKCHLYWPNEMGADKALKLPHVKLTV--- 164
            :||.||.|||..||.||            .:|:..|| ..::.|....|.:..:.|.:.|..   
 Worm   187 VTQYPLPDTVRDFWRMV------------SIMKVTQI-VTIFEPQTDEAIEEFRNPTLTLAAPAP 238

  Fly   165 --------------------------ELVRLET--------------YQNFVRRWFKLTDLETQQ 189
                                      :.:|.|:              |.| ::.|...|...|..
 Worm   239 TSTMTTIGGFPVPIGQIAHNRDQIQGQSIRCESNVHRSSFFPLETDHYMN-LKGWLINTRRVTVD 302

  Fly   190 SR----------EVMQ-----------FHYTTWPDFGIPSSPNAFLKFLQQVRDSGCLS-----R 228
            .|          ||:.           ::.||||....|......|..::........|     .
 Worm   303 HRNKGWMNKYTVEVVAEGCSEATFAKVYNCTTWPWKKYPDDEKKVLALVRAPYKDTSTSLIANLE 367

  Fly   229 DVGPAVVHCSAGIGRSGTFCLVDCCL--VLIDKYGECNVSKVLCELRSYRMGLIQTADQLDFSYQ 291
            .:.|.||.|..|:.||.|..|....:  ::..|..:|:.  :..::|..|.|:...:....::.:
 Worm   368 KLAPIVVMCDLGLDRSATVVLTSIIIDQIIAGKTPDCDA--LFKKMRDQRAGVFTMSIFYTYAIR 430

  Fly   292 AIIEGIK-KLHDPTFLDAEE------------PLISNDTE 318
            |.:..:| ||........||            |.::..|:
 Worm   431 AALFYMKIKLQTMNDAGGEEMQTMLNSALAKVPFVTKKTK 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp61FNP_476687.1 PTPc 34..295 CDD:214550 65/327 (20%)
PTPc 62..295 CDD:238006 60/312 (19%)
K07F5.6NP_501764.2 eIF1_SUI1_like <30..>110 CDD:294159
PTPc 111..434 CDD:214550 65/327 (20%)
PTPc 138..433 CDD:304379 62/321 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.