DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp61F and ptp-5.1

DIOPT Version :9

Sequence 1:NP_476687.1 Gene:Ptp61F / 38160 FlyBaseID:FBgn0267487 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_500733.2 Gene:ptp-5.1 / 177291 WormBaseID:WBGene00016053 Length:482 Species:Caenorhabditis elegans


Alignment Length:336 Identity:65/336 - (19%)
Similarity:125/336 - (37%) Gaps:97/336 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KTSGSGSAAAARLQIEAEYKDKGPQW--HRFYKEICETCDREAKEKQFSTSESER---------- 57
            |||.:|:|            ||   |  ....|...::.|....:|.|...::.:          
 Worm   157 KTSITGNA------------DK---WVGEDVAKTWMDSIDLAEVKKDFEKLQTMKIDIDKDCKTW 206

  Fly    58 HTNRGLNRYRDVNPYDHSRIVLKRGSVDYINANLVQLERAERQYILTQGPLVDTVGHFWLMVWEQ 122
            ..|..||:.......|.:.:.:::|   |:|.:.|::......:| .|.|:.||...||..|:::
 Worm   207 KANSKLNQSEHFPALDSNLLKIEKG---YVNISHVEVPLGRNVHI-GQFPVKDTEETFWKAVFDK 267

  Fly   123 KSRAVLMLNKLMEKKQIKCHLYWPNEMGADKALKLPHVKLTVELVRLETYQNFVRRWFKLTDLET 187
            :   :..::.|:..:.|:   ::|.                    :.|.|:|:.:.|.....:| 
 Worm   268 R---ITSIDVLVGDEPIE---FFPK--------------------KAEDYKNYGQMWINNRKVE- 305

  Fly   188 QQSREVMQF---------------HYTTWPDFGIPSSP-------------NAFLKFLQQVRDSG 224
            ....||.:|               :.|.:.::.:.|.|             |.||  |:...|..
 Worm   306 HVIDEVFRFSIEVLPHGCSNSIICNVTVFGNWKVDSVPVKQAIAIKEALGLNYFL--LKTPADDN 368

  Fly   225 CLSRDVGPAVVHCSAGIGRSGTFCLVDCCLVLID-KYGECNVSKVLCELRSYRMGLIQTADQLDF 288
                    |::....|.||:|.|..:...:..|| |..|.|::.::..:|:.|...:.:..|...
 Worm   369 --------AMIISPHGAGRAGYFLALAVAVHTIDTKIAEPNIADIVKSIRTQRPRAVDSFCQYCS 425

  Fly   289 SYQAIIEGIKK 299
            .|.:::..|||
 Worm   426 LYISLLYFIKK 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp61FNP_476687.1 PTPc 34..295 CDD:214550 54/299 (18%)
PTPc 62..295 CDD:238006 49/261 (19%)
ptp-5.1NP_500733.2 PTPc 185..432 CDD:214550 52/287 (18%)
PTPc_motif 334..432 CDD:214649 22/107 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.