DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp61F and B0280.11

DIOPT Version :9

Sequence 1:NP_476687.1 Gene:Ptp61F / 38160 FlyBaseID:FBgn0267487 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_498560.2 Gene:B0280.11 / 175997 WormBaseID:WBGene00015106 Length:441 Species:Caenorhabditis elegans


Alignment Length:387 Identity:83/387 - (21%)
Similarity:145/387 - (37%) Gaps:82/387 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EQKTSGSGSAAAARLQIEAEYKDKGPQWHRFYKEICETCDREAKEKQFSTSESERHTNRGLNRY- 66
            |....|...|..|: ::|.:.::.||      .:...|......|.|...|.:.::..:|:..: 
 Worm    72 EVTAKGFKKAKDAK-KLEKKKEETGP------SKTPSTIALRRAESQMELSGNRKNVEKGVKTWV 129

  Fly    67 --------------RDVNPYDHSRIVLK-----RGSVDYINANLVQLERAER------------- 99
                          .|..|.|..::.|:     :.::||..:..|:|..|.|             
 Worm   130 EQLEKLVEIRKLLEADFKPIDTMKVDLEKCQAFKKNIDYCQSENVELYDANRVKGGGEADFFYHA 194

  Fly   100 -----------QYILTQGPLVD---TVGHFWLMVWEQKSRAVLMLNKLMEKKQIKCHLYWPNEMG 150
                       ..||.|.||.|   ::..|||||..||.:.:.:|....|..:.....|:|.:..
 Worm   195 TVTSIPSISTKSTILAQLPLSDSPHSLESFWLMVAAQKIQRLFILIGEDELDKAALSEYFPEDFK 259

  Fly   151 ADKALKLPHVKLTVELVRLETYQNFVRRWFKLTDLETQQSR----EVMQFHYTTWPDFGIPS-SP 210
            ..|.:::.:.|    .|.....|...:.::::...:..::.    |:..|    |||..||: |.
 Worm   260 EFKTIRVNNRK----TVSKSDEQPNTQLYYEVVPKDCAEAPFAMIEICDF----WPDGKIPTVSY 316

  Fly   211 NAFLKFLQQVRDSGCLSRDVGPAVVHCSAGIGRSGTFCLVDCCLVLIDKYGECNVSKVLCELRSY 275
            .........|.||. :..|...|:| .:.|.||:|:|.:....:..:......|:.::...:||.
 Worm   317 GRIAATAASVFDSD-IDSDATCAIV-SNYGAGRAGSFLVGVQAIEKLQAGDAPNIKEIAMSIRSQ 379

  Fly   276 RMGLIQTADQLDFSY-QAIIEGIKKLHDPTFLDAEEPLIS------------NDTETHTLDE 324
            |...|:|..|..|:| .|:..|:|.:.||......|.:||            .|.|.:|..|
 Worm   380 RPCAIETLPQYVFTYIIALTYGLKHVKDPVLKSKTEKVISQLEQFACEKMMEEDEEDNTTCE 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp61FNP_476687.1 PTPc 34..295 CDD:214550 65/313 (21%)
PTPc 62..295 CDD:238006 61/285 (21%)
B0280.11NP_498560.2 PTPc 141..398 CDD:214550 59/266 (22%)
PTPc 177..394 CDD:304379 50/226 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.