DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp61F and egg-5

DIOPT Version :9

Sequence 1:NP_476687.1 Gene:Ptp61F / 38160 FlyBaseID:FBgn0267487 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_491316.1 Gene:egg-5 / 172007 WormBaseID:WBGene00020035 Length:753 Species:Caenorhabditis elegans


Alignment Length:352 Identity:90/352 - (25%)
Similarity:153/352 - (43%) Gaps:77/352 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 REAK---------EKQFSTSESE------RHTNRGLNRYRDVNP----YDHSRIVLK--RGSV-- 84
            |:||         |::|...|:.      .|:....|:.:..||    .|.:||.|:  ||..  
 Worm   396 RKAKYLSTIIGGMERRFEILENSVNHIPFTHSASDNNQEKCRNPRVHCRDSTRIALQFPRGQYLG 460

  Fly    85 DYINANLVQLERAERQYILTQGPLVDTVGHFWLMVWEQKSRAVLMLNKLMEKKQIKCHLYWPNEM 149
            |:|:||.:..:....::|:||.|:.:||..||.|||:::...::||..  .|:..:|..||| :.
 Worm   461 DFIHANRISGKPLFNEFIMTQAPMKNTVDDFWRMVWQEEVPYIVMLTS--RKEPERCEYYWP-KS 522

  Fly   150 GADKALKLPHVKLTVELVRLETYQNFVR--RWFKLTDLE-TQQSREVMQFHYTTWPDFGIPSSPN 211
            .:|.|:.:|..      :|:|.:..:..  ..|::|.|. ....||  :.|...|.. .:.:|.|
 Worm   523 PSDPAVTVPGG------LRIENFGVYQAPDPLFRVTHLRLIGPDRE--ERHVEHWQG-DVNNSSN 578

  Fly   212 AF--LKFLQQVRDSGCLSRDVGPAVVHCSAGIGRSGTFCLVDC----CLVLIDKYGECNVSKVLC 270
            .:  |..|:.:|::.      .|.|:|...|:.|:.  |||..    |.:|.....:..|.:.:.
 Worm   579 MYSPLNILRLLRNAS------KPVVIHDHLGVSRAA--CLVAAEIAICSLLRGPTYKYPVQRAVQ 635

  Fly   271 ELRSYRMGLIQTADQ-------LDFSYQAIIEGIKKLHDPTFLDAE-EPLISNDTETHTLDELPP 327
            .||..|...|:|..|       :.|.::.:|...|:      ||.: |..:...:|...||:|..
 Worm   636 FLRQRRPFSIETPMQYIFVHRLVAFFFRDVIGSAKE------LDVDYERWLQERSERMFLDDLAA 694

  Fly   328 PLP------PR-----VQSLNLPLAPN 343
            |:|      ||     |:.:..|..||
 Worm   695 PIPGYRLLSPRADPDIVRMVGRPERPN 721

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp61FNP_476687.1 PTPc 34..295 CDD:214550 73/290 (25%)
PTPc 62..295 CDD:238006 66/256 (26%)
egg-5NP_491316.1 PTPc 407..660 CDD:214550 69/272 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.