DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp61F and F47B3.7

DIOPT Version :9

Sequence 1:NP_476687.1 Gene:Ptp61F / 38160 FlyBaseID:FBgn0267487 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_491276.1 Gene:F47B3.7 / 171983 WormBaseID:WBGene00018531 Length:374 Species:Caenorhabditis elegans


Alignment Length:292 Identity:85/292 - (29%)
Similarity:143/292 - (48%) Gaps:29/292 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 W--HRFYKEICETCDR--EAKEKQFSTSESERHTNRGLNRYRDVNPYDHSRIVLKR--GSVDYIN 88
            |  |...|.:.:..|.  |...|..:.......:|...|||.|:...:.:|::|..  .|.|||:
 Worm    56 WVHHTLNKGVSKLRDEFSEVANKNPNVPVDAFKSNPEKNRYTDIKCIEKTRVILTTDGASSDYIH 120

  Fly    89 ANLVQLERAERQYILTQGPLVDTVGHFWLMVWEQKSRAVLMLNKLMEKKQIKCHLYWPNEMGADK 153
            ||.|.:....:::|.||||...|:..||.||.:....:::||.|::|..::||..|||...|...
 Worm   121 ANYVGISIKPKKFICTQGPKDSTIYDFWAMVIQDNVESIIMLCKVIELARVKCEQYWPAVEGQTN 185

  Fly   154 ALKLPHVKLTVELVRLETY---QNFVRRWFKLTDLE---TQQSREVMQFHYTTWPDFGIPSSPNA 212
            ........:|:..:.:.|.   .:|:    .:|:||   ..::|.:..:.:|.|||.|.|.....
 Worm   186 TYVSKGHTITINNLGVGTLSPDDDFI----NVTNLELVWAGKTRSITHYQWTNWPDHGAPPINMG 246

  Fly   213 FLKFLQQVRDSGCLSRDVGPAVVHCSAGIGRSGTFCLVDCCLVLIDKYGE---C-NVSKVLCELR 273
            .:..::.|      :.|..|.|||||||:|||||  :|...|:: ||..:   | ::.|::.|:|
 Worm   247 AINLIEAV------NYDTNPVVVHCSAGVGRSGT--IVGISLIM-DKMIQGINCKDMKKLVEEIR 302

  Fly   274 SYRMGLIQTADQLDFSYQAIIEGIKKLHDPTF 305
            :.|...|||..|..:.::.::|...:||..|:
 Worm   303 NQRHYAIQTEAQYMYIHRVLLEYFLELHKETY 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp61FNP_476687.1 PTPc 34..295 CDD:214550 79/274 (29%)
PTPc 62..295 CDD:238006 74/244 (30%)
F47B3.7NP_491276.1 Y_phosphatase 90..324 CDD:278528 75/246 (30%)
PTPc 92..324 CDD:238006 74/244 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.