DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp61F and Y48G1C.5

DIOPT Version :9

Sequence 1:NP_476687.1 Gene:Ptp61F / 38160 FlyBaseID:FBgn0267487 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_490668.4 Gene:Y48G1C.5 / 171595 WormBaseID:WBGene00021678 Length:1161 Species:Caenorhabditis elegans


Alignment Length:274 Identity:65/274 - (23%)
Similarity:108/274 - (39%) Gaps:67/274 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 YDHSRIVLKRGSVDYINANLVQLERAERQYILTQGPL--VD-------TVGHFWLMVWEQKSRAV 127
            |:.|:   |.|..:  ::::|:|:.. .:::|...|.  ||       .:..||..|...|...:
 Worm   897 YESSK---KNGQGE--SSHVVELDNG-LKFVLMPAPQLPVDKKSSDILAIAAFWESVKLNKPSTI 955

  Fly   128 LMLNKLME------KKQIKCHLYWPNEMGADKALKLPHVKLT----VELVRLETYQNFVRRWFKL 182
            :||....|      ..::.|..|:|.|:  |:.|.|..:.:|    :....|:|.|       .|
 Worm   956 VMLCDFAEIDHFIGANKVNCDRYFPTEL--DEKLILADLTITCTKSISKPLLKTRQ-------LL 1011

  Fly   183 TDLETQQSREVMQFHYTTWPDFGIPSSPNAFLKFLQQVRDSGCLSRDVGPAVVHCSAGIGRSGTF 247
            .....::::||..:.||.||:...|.........|:.|.||      ..|..|.|:.|.|||..|
 Worm  1012 LTFGKKRTQEVTHYQYTGWPEHMGPKDAEEIRYLLKLVTDS------ERPVFVVCNTGGGRSAAF 1070

  Fly   248 CLVDCCLVLID--KYGECNVSKVLCELRSYR-----------------MGLIQTADQLDFSYQAI 293
            .|::.....|:  :.||.|...::.:.||.|                 :.|...|:..|.:|...
 Worm  1071 VLIESLFQAINTSETGEINYRSLIEQTRSKRKCAAPDPIYLAFAFYTTLTLFYPANAHDDAYVTQ 1135

  Fly   294 I--------EGIKK 299
            |        ||:||
 Worm  1136 ICRMYFDANEGLKK 1149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp61FNP_476687.1 PTPc 34..295 CDD:214550 61/268 (23%)
PTPc 62..295 CDD:238006 61/268 (23%)
Y48G1C.5NP_490668.4 WSN 47..111 CDD:280385
PTPc <940..1085 CDD:304379 40/159 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.