DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KLK1 and alphaTry

DIOPT Version :9

Sequence 1:NP_002248.1 Gene:KLK1 / 3816 HGNCID:6357 Length:262 Species:Homo sapiens
Sequence 2:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster


Alignment Length:270 Identity:80/270 - (29%)
Similarity:119/270 - (44%) Gaps:40/270 - (14%)


- Green bases have known domain annotations that are detailed below.


Human     4 LVLCLALSLGGT---GAAPPIQSRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWVLTAAH 65
            |:..:..:||||   |..|.:..|||||......|.|||.:|....:..|||.:.....::||||
  Fly     7 LLSAVVCALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAH 71

Human    66 CISD----------NYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHD 120
            |:..          ....|         .:......||....|.|:|.:.:.|           |
  Fly    72 CLQSVSASVLQVRAGSTYW---------SSGGVVAKVSSFKNHEGYNANTMVN-----------D 116

Human   121 LMLLRLTEPADTITDAVKVVELPTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKILPNDEC 185
            :.::||:... :.:.::|.:.|.|..|..|::...||||:....:.|.|..||.|::.|:...:|
  Fly   117 IAVIRLSSSL-SFSSSIKAISLATYNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQC 180

Human   186 KKA---HVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNKPSVAVRV 247
            ..:   :..::.:.|:|..  ..|||.|.|||||||:..|||.||.|||| .|...|.|.|...|
  Fly   181 ASSTYGYGSQIRNTMICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWGY-GCAYSNYPGVYADV 242

Human   248 LSYVKWIEDT 257
            .....|:..|
  Fly   243 AVLRSWVVST 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KLK1NP_002248.1 Tryp_SPc 25..257 CDD:238113 71/244 (29%)
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 71/242 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5403
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.