DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2199 and ZNF764

DIOPT Version :9

Sequence 1:NP_728599.1 Gene:CG2199 / 38159 FlyBaseID:FBgn0035213 Length:733 Species:Drosophila melanogaster
Sequence 2:NP_219363.2 Gene:ZNF764 / 92595 HGNCID:28200 Length:408 Species:Homo sapiens


Alignment Length:490 Identity:80/490 - (16%)
Similarity:133/490 - (27%) Gaps:189/490 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 CIKTFGVLKTLKNHL-RDTHSRTF-------------------ESEAKTKAKESKEKEAKSGAKN 308
            |.:.:|.|:..:..| ||....|:                   |.||:.....:::.|.      
Human    36 CREEWGCLRPAQRALYRDVMRETYGHLSALGIGGNKPALISWVEEEAELWGPAAQDPEV------ 94

  Fly   309 KIDAKAK-ETNAVSQRKKPKEKKSKEKKTEIKCNVETKVVDEIDDQVNNKKGTDSEDADQTQATK 372
               ||.: :|:....|.|.||::.:          .|..:::.|.......|..|..|  ..|..
Human    95 ---AKCQTQTDPADSRNKKKERQRE----------GTGALEKPDPVAAGSPGLKSPQA--PSAGP 144

  Fly   373 IASFKALNESLMKKRMLENVIDSEYTFAINGSSASTPRADSNNFQCEICDCELMTAKQMQEHMKT 437
            ...::.|:::..:.|            ....:....||||..: .|.:|.........:.||:.:
Human   145 PYGWEQLSKAPHRGR------------PSLCAHPPVPRADQRH-GCYVCGKSFAWRSTLVEHVYS 196

  Fly   438 VHSIDKPKVFKCHVCEKSLATKQSLKTHMTLHADGAEAPNSSKRKILQDEDEDVDILGTTQIENT 502
             |:.:||  |.|..|.|......||..|..:|                                 
Human   197 -HTGEKP--FHCTDCGKGFGHASSLSKHRAIH--------------------------------- 225

  Fly   503 AEKVEGPKKSQQSPTKAAKFTNRKILQEEDEVVEIVDAFKTDNTAEDDEGPAEEKIIRSRNNIQH 567
              :.|.|.:..:.   ...||.|..|                                       
Human   226 --RGERPHRCLEC---GRAFTQRSAL--------------------------------------- 246

  Fly   568 QVDGGMIAPRSPAKKTKKTSHVDLSVSTTNGNSP---AKSEKRKKQDKSEDTLPSSDVDIVEEIN 629
                              |||  |.|.|  |..|   |...:|..|..:                
Human   247 ------------------TSH--LRVHT--GEKPYGCADCGRRFSQSSA---------------- 273

  Fly   630 YNVRPHKKARLESIGDSTADESTLSCDRCGKFVKSRQRLDSHMEKKHAAK-LQCTLCKEVYQNQM 693
              :..|::..        :.|:...|..||:.......|..|:......| ..|..|...::...
Human   274 --LYQHRRVH--------SGETPFPCPDCGRAFAYPSDLRRHVRTHTGEKPYPCPDCGRCFRQSS 328

  Fly   694 DYVAHFSNCGSEGGLPCGVANCKKVFTEANFLSSH 728
            :..||......|...||  ..|.:.|.:.:.::.|
Human   329 EMAAHRRTHSGEKPYPC--PQCGRRFGQKSAVAKH 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2199NP_728599.1 C2H2 Zn finger 418..439 CDD:275370 4/20 (20%)
C2H2 Zn finger 449..469 CDD:275370 6/19 (32%)
ZNF764NP_219363.2 zf-H2C2_2 301..326 CDD:290200 5/24 (21%)
C2H2 Zn finger 317..337 CDD:275368 4/19 (21%)
zf-H2C2_2 333..352 CDD:290200 5/20 (25%)
C2H2 Zn finger 345..365 CDD:275368 4/19 (21%)
KRAB 26..85 CDD:214630 10/48 (21%)
KRAB 26..65 CDD:279668 7/28 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..167 16/108 (15%)
C2H2 Zn finger 177..197 CDD:275368 4/20 (20%)
zf-H2C2_2 190..212 CDD:290200 9/24 (38%)
C2H2 Zn finger 205..225 CDD:275368 6/19 (32%)
zf-H2C2_2 217..242 CDD:290200 7/62 (11%)
COG5048 229..>294 CDD:227381 20/154 (13%)
C2H2 Zn finger 233..253 CDD:275368 8/81 (10%)
zf-H2C2_2 245..270 CDD:290200 11/85 (13%)
C2H2 Zn finger 261..281 CDD:275368 4/37 (11%)
zf-H2C2_2 273..298 CDD:290200 5/50 (10%)
COG5048 285..>350 CDD:227381 14/66 (21%)
C2H2 Zn finger 289..309 CDD:275368 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142300
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.