DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG2199 and Zfp688

DIOPT Version :9

Sequence 1:	NP_728599.1	Gene:	CG2199 / 38159	FlyBaseID:	FBgn0035213	Length:	733	Species:	Drosophila melanogaster
Sequence 2:	NP_081275.3	Gene:	Zfp688 / 69234	MGIID:	1916484	Length:	274	Species:	Mus musculus

Alignment Length:	110	Identity:	21/110 - (19%)
Similarity:	36/110 - (32%)	Gaps:	29/110 - (26%)

- Green bases have known domain annotations that are detailed below.

  Fly   383 LMKKRMLENVIDSEYTFAINGSSASTP-----------------------RADSNNFQCEICDCE 424
            |..|.::|:   ..|:.|...|:.:.|                       :|......|..|...
Mouse   128 LQPKEVVEH---KTYSMATKSSAGAQPPTKAAPDQIAGVQLPVQVPNTDIQASQRRHVCVDCGRR 189

  Fly   425 LMTAKQMQEHMKTVHSIDKPKVFKCHVCEKSLATKQSLKTHMTLH 469
            ......:..| :.:||.::|  |.|..|......|.::|.|..:|
Mouse   190 FTYPSLLVSH-RRMHSGERP--FPCPECGVRFKRKFAVKAHQWIH 231

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG2199	NP_728599.1	C2H2 Zn finger	418..439	CDD:275370	3/20 (15%)
CG2199	NP_728599.1	C2H2 Zn finger	449..469	CDD:275370	5/19 (26%)
Zfp688	NP_081275.3	KRAB	26..86	CDD:214630
		KRAB	26..65	CDD:279668
		COG5048	<166..>233	CDD:227381	14/69 (20%)
		zf-C2H2	181..203	CDD:278523	3/22 (14%)
		C2H2 Zn finger	183..203	CDD:275368	3/20 (15%)
		zf-H2C2_2	196..220	CDD:290200	7/26 (27%)
		C2H2 Zn finger	211..231	CDD:275368	5/19 (26%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C167832303
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.930