DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2199 and ZNF747

DIOPT Version :9

Sequence 1:NP_728599.1 Gene:CG2199 / 38159 FlyBaseID:FBgn0035213 Length:733 Species:Drosophila melanogaster
Sequence 2:NP_001291947.1 Gene:ZNF747 / 65988 HGNCID:28350 Length:331 Species:Homo sapiens


Alignment Length:164 Identity:42/164 - (25%)
Similarity:59/164 - (35%) Gaps:34/164 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   333 EKKTEI-----------KCNVETKVVDEID-DQVNNKKGTDS-EDADQTQA------TKIASFKA 378
            |:|.|:           ||..|....|..: ::...::||.: |..|...|      ...|.|..
Human    90 EEKAELWDPAAQDPEVAKCPTEADPADSRNKEEERQREGTGALEKPDPVAAGSPGLKAPQAPFAG 154

  Fly   379 LNESLMKKRMLENVIDSEYTFAINGSSASTPRADSNNFQCEICDCELMTAKQMQEHMKTVHSIDK 443
            | |.|.|.|.     .|...|.   :....||||..: .|.:|.........:.||:.: |..:|
Human   155 L-EQLSKARR-----RSRPRFF---AHPPVPRADQRH-GCYVCGKSFAWRSTLVEHIYS-HRGEK 208

  Fly   444 PKVFKCHVCEKSLATKQSLKTHMTLHADGAEAPN 477
            |  |.|..|.|......||..|..:|.  .|.|:
Human   209 P--FHCADCGKGFGHASSLSKHRAIHR--GERPH 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2199NP_728599.1 C2H2 Zn finger 418..439 CDD:275370 4/20 (20%)
C2H2 Zn finger 449..469 CDD:275370 6/19 (32%)
ZNF747NP_001291947.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
KRAB 37..96 CDD:214630 3/5 (60%)
KRAB 37..76 CDD:279668
C2H2 Zn finger 184..204 CDD:275368 4/20 (20%)
zf-H2C2_2 197..219 CDD:290200 9/24 (38%)
C2H2 Zn finger 212..232 CDD:275368 6/19 (32%)
zf-H2C2_2 224..247 CDD:290200 6/17 (35%)
COG5048 236..>273 CDD:227381 1/3 (33%)
C2H2 Zn finger 240..260 CDD:275368
zf-H2C2_2 252..275 CDD:290200
C2H2 Zn finger 268..288 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142305
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.