Sequence 1: | NP_728599.1 | Gene: | CG2199 / 38159 | FlyBaseID: | FBgn0035213 | Length: | 733 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_016882467.1 | Gene: | ZNF302 / 55900 | HGNCID: | 13848 | Length: | 444 | Species: | Homo sapiens |
Alignment Length: | 393 | Identity: | 69/393 - (17%) |
---|---|---|---|
Similarity: | 123/393 - (31%) | Gaps: | 162/393 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 162 KKQISRLFEDNLNDSVKLTPAKEVSSTKKAFLNLFGNGGNDAIEVLTESEEEEDSDKGPITI--- 223
Fly 224 --------NTN-NFQCPECE-----FHAK--FPKP--------------YKEHLQKEHGLQ---- 254
Fly 255 -----------------------------RPRIYPCTLCIKTFGVLKTLKNHLR-DTHSRTFESE 289
Fly 290 --AKTKAKES---KEKEAKSGAKNKIDAKAKETNAVSQRKKPKEKKSKEKKTEIKCNVETKVVDE 349
Fly 350 IDDQVNNKKGTDSEDADQTQATKIASFKALNESLMKKRMLENVIDSEYTFAINGSSASTPRADSN 414
Fly 415 NFQCEICDCELMTAKQMQEHMKTVHSIDKPKVFKCHVCEKSLATKQSLKTHMTLHADGAEAPNSS 479
Fly 480 KRK 482 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG2199 | NP_728599.1 | C2H2 Zn finger | 418..439 | CDD:275370 | 5/20 (25%) |
C2H2 Zn finger | 449..469 | CDD:275370 | 5/19 (26%) | ||
ZNF302 | XP_016882467.1 | KRAB | 48..109 | CDD:214630 | |
COG5048 | <151..393 | CDD:227381 | 50/295 (17%) | ||
C2H2 Zn finger | 248..268 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 276..296 | CDD:275368 | 3/19 (16%) | ||
C2H2 Zn finger | 304..324 | CDD:275368 | 3/20 (15%) | ||
C2H2 Zn finger | 332..352 | CDD:275368 | 3/40 (8%) | ||
C2H2 Zn finger | 360..380 | CDD:275368 | 5/20 (25%) | ||
C2H2 Zn finger | 388..408 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 416..436 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165142434 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |