DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2199 and Sry-delta

DIOPT Version :9

Sequence 1:NP_728599.1 Gene:CG2199 / 38159 FlyBaseID:FBgn0035213 Length:733 Species:Drosophila melanogaster
Sequence 2:NP_524581.1 Gene:Sry-delta / 43572 FlyBaseID:FBgn0003512 Length:433 Species:Drosophila melanogaster


Alignment Length:527 Identity:96/527 - (18%)
Similarity:175/527 - (33%) Gaps:141/527 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 LNLFGNGGNDAIEVLTESEEEEDSDKGPITINTNNFQCPECEFHAKFPKPYKEHLQKEHGLQRPR 257
            ::|...|.:.::...|.|.:...|.|....:.|:...|.:.:...|                 |.
  Fly    10 VDLSDTGSSSSMRYETLSAKVPSSQKTVSLVLTHLANCIQTQLDLK-----------------PG 57

  Fly   258 IYPCTLCIKTFGVLKTLKNHLRDTHSR-TFESEAKTKAK---------------ESKEKEAKSGA 306
            ...|..|.:......|:..:|..|..| |.:.:...|::               |..:.:.::.|
  Fly    58 ARLCPRCFQELSDYDTIMVNLMTTQKRLTTQLKGALKSEFEVPESGEDILVEEVEIPQSDVETDA 122

  Fly   307 KNKIDAKAKETNAVSQRKKPKEKKSKEKKTEIKCNVETKVVDEIDDQVNNKKGTDSEDADQTQAT 371
            ..:.||...|.          .|..:|..||||    .:.|||.:::       |.:|.|:....
  Fly   123 DAEADALFVEL----------VKDQEESDTEIK----REFVDEEEEE-------DDDDDDEFICE 166

  Fly   372 KIASFKALNESLMKKRMLENVIDSEYTFAINGSSASTPRADSNNFQCEICDCELMTAKQMQEHMK 436
            .:                 :|.|||..:..:......|.......:|..|.....:..|:|:|:.
  Fly   167 DV-----------------DVGDSEALYGKSSDGEDRPTKKRVKQECTTCGKVYNSWYQLQKHIS 214

  Fly   437 TVHSIDKPKVFKCHVCEKSLATKQSLKTHMTLHADGAE-----APNSSKRKILQDEDEDVDILGT 496
            ..||  |.....|.:|......::.|:.||.||....|     .|.|..|.:             
  Fly   215 EEHS--KQPNHICPICGVIRRDEEYLELHMNLHEGKTEKQCRYCPKSFSRPV------------- 264

  Fly   497 TQIENTAE--KVEGPKKSQQSPTKAAKFT------NRKILQEEDE---VVEIVD-AFKTDNTAED 549
                ||..  ::...||..|......:|:      |.::..|.:|   :..|.: :||:..|.. 
  Fly   265 ----NTLRHMRMHWDKKKYQCEKCGLRFSQDNLLYNHRLRHEAEENPIICSICNVSFKSRKTFN- 324

  Fly   550 DEGPAEEKIIRSRNNIQHQVDGGMIAPRS-----PAKKTKKTSHVDLSVSTTNGNSPAKSEKRKK 609
                 ...:|...|..:|...   :.|:|     ..|...||...|:....              
  Fly   325 -----HHTLIHKENRPRHYCS---VCPKSFTERYTLKMHMKTHEGDVVYGV-------------- 367

  Fly   610 QDKSEDTLPSSDVDIVEEINYNVRPHKKARLESIGDSTADESTLSCDRCGKFVKSRQRLDSHMEK 674
                .:..|:.:..:|||::.:|...:.|....:.|:  ||::..|..|....::::.|:.|::.
  Fly   368 ----REEAPADEQQVVEELHVDVDESEAAVTVIMSDN--DENSGFCLICNTNFENKKELEHHLQF 426

  Fly   675 KHAAKLQ 681
            .|...|:
  Fly   427 DHDVVLK 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2199NP_728599.1 C2H2 Zn finger 418..439 CDD:275370 5/20 (25%)
C2H2 Zn finger 449..469 CDD:275370 5/19 (26%)
Sry-deltaNP_524581.1 COG5048 <205..360 CDD:227381 38/182 (21%)
C2H2 Zn finger 225..245 CDD:275368 5/19 (26%)
C2H2 Zn finger 253..273 CDD:275368 5/36 (14%)
C2H2 Zn finger 281..301 CDD:275368 2/19 (11%)
C2H2 Zn finger 310..327 CDD:275370 4/22 (18%)
zf-C2H2 337..359 CDD:278523 5/24 (21%)
C2H2 Zn finger 339..359 CDD:275368 4/22 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440000
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.