DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2199 and CG10654

DIOPT Version :9

Sequence 1:NP_728599.1 Gene:CG2199 / 38159 FlyBaseID:FBgn0035213 Length:733 Species:Drosophila melanogaster
Sequence 2:NP_001261767.1 Gene:CG10654 / 39428 FlyBaseID:FBgn0036294 Length:412 Species:Drosophila melanogaster


Alignment Length:456 Identity:82/456 - (17%)
Similarity:139/456 - (30%) Gaps:165/456 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 RSIPSSLPIK-ICFVCTSTFMSSAALIEKVRETVDRVQEQPAKKTKVAE--------IEEPSTQE 108
            |.:|..|.:| ||..|..       |::|..:......|......|:.:        :|:.:..:
  Fly    76 RDLPPQLVLKSICECCYQ-------LVQKFHDFQRMCAESLRNFEKLLQDIDIGCHKLEDHTWHD 133

  Fly   109 SDKKAVKVPKKNTTLRQRSKSIAAFPP--SFV----------------NGANTNTEIEIISASPK 155
            .|..:......|...:..:..|||...  ||:                .||:...|:.:|.....
  Fly   134 LDTPSESNESTNPEAQSHAPCIAATQEIVSFIWPQVCLPLAVILSRITLGASLEEEVYVIEDESA 198

  Fly   156 KLDKTPKKQISRLFEDNLNDSVKLTPAKEVSSTKKAFLNLFGNGGNDAIEVLTESEEEEDSDKGP 220
            |.|         |.::.|:.|.||..|::....:                               
  Fly   199 KQD---------LGQEKLSISSKLLGARKRRGVR------------------------------- 223

  Fly   221 ITINTNNFQCPECEFHAKFPKP--YKEHLQKEHGLQRPRIYPCTLCIKTFGVLKTLKNHLRDTHS 283
                 :..:|..|  |..|.||  .:.|:|:..|| ||  |.|..|.|::.....|::|||..| 
  Fly   224 -----HTLECRIC--HRGFYKPSLLEAHMQQHEGL-RP--YTCVHCAKSYARANLLESHLRQMH- 277

  Fly   284 RTFESEAKTKAKESKEKEAKSGAKNKIDA--------KAKETNAVSQRKKPKEKKSKEKKTEIKC 340
                                    |..||        ...:....::..|...:::.|:..|   
  Fly   278 ------------------------NNADAARIIYACPSCNKVYTANRSLKYHMRRTHERYHE--- 315

  Fly   341 NVETKVVDEIDDQVNNKKGTDSEDADQ--TQATKIASFKALNESLMKKRMLENVIDSEYTFAING 403
                               ::|.||..  .:..|..:.||   .|.:.:|            ::|
  Fly   316 -------------------SESPDARHICEECGKCFARKA---HLTRHKM------------VHG 346

  Fly   404 SSASTPRADSNNFQCEICDCELMTAKQMQEHMKTVHSIDKPKVFKCHVCEKSLATKQSLKTHMTL 468
            |      .:...:.||.||....|.:.|.:|:...|. :|..:.:|..|.:.......|..|...
  Fly   347 S------VEGRRYCCECCDRRFYTKENMVDHLLRKHG-NKNLLLRCRKCGRIFQNSVELNAHGRK 404

  Fly   469 H 469
            |
  Fly   405 H 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2199NP_728599.1 C2H2 Zn finger 418..439 CDD:275370 7/20 (35%)
C2H2 Zn finger 449..469 CDD:275370 4/19 (21%)
CG10654NP_001261767.1 zf-AD 39..115 CDD:285071 10/45 (22%)
C2H2 Zn finger 228..248 CDD:275368 8/21 (38%)
C2H2 Zn finger 256..313 CDD:275368 13/81 (16%)
C2H2 Zn finger 289..314 CDD:275368 2/24 (8%)
zf-C2H2 323..345 CDD:278523 5/36 (14%)
C2H2 Zn finger 325..345 CDD:275368 5/34 (15%)
C2H2 Zn finger 355..376 CDD:275368 7/20 (35%)
C2H2 Zn finger 385..405 CDD:275368 4/19 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440005
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.