DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2199 and CG8089

DIOPT Version :9

Sequence 1:NP_728599.1 Gene:CG2199 / 38159 FlyBaseID:FBgn0035213 Length:733 Species:Drosophila melanogaster
Sequence 2:NP_611014.1 Gene:CG8089 / 36679 FlyBaseID:FBgn0033993 Length:624 Species:Drosophila melanogaster


Alignment Length:667 Identity:133/667 - (19%)
Similarity:230/667 - (34%) Gaps:194/667 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LCENMTKVQK-------------EVRCDHCGTSQGSK--------SVF-----SGQKVFLGRKIT 44
            |||::.|:.:             ::| |:..|::..|        ::|     ..:||.| .|:.
  Fly    67 LCEDVQKIMRFRSSDMLLLLRTAQLR-DNFWTNEYFKADLQDDFRAIFDAFEEKNRKVQL-EKLA 129

  Fly    45 DVLETIT---HRSIP--------SSLPIKICFVCTSTFMSSAALIEKVRETVDRVQEQPAKKTKV 98
            .:|:|::   .||:.        .:|..||          :|..:..:|....:.:..|.||.:.
  Fly   130 AILDTVSSGYRRSVSQLAGQEAHGALRPKI----------AALFLPGLRCDCYKCENLPWKKLQD 184

  Fly    99 AEIEEPSTQESDKKAVKVPKKNTTLRQRSKSIAAFPPSFVNGANTNTEIEIISASPKKLDKTPKK 163
            .|..:.:.:.||....::..:...|:....|                  .||..|....:....|
  Fly   185 VEDHQKTHRYSDNFHCQICYRRFYLQHSLTS------------------HIIRKSTSSRELHENK 231

  Fly   164 QISRLFEDNLNDSVKLTPAKEVSSTKKAFLNLFGNGGNDAIEVLTESEEE--EDSDKGPITINTN 226
            :..||.|:.             .|.::..|.|..|...|.:..:.|..:.  :|..|.||.....
  Fly   232 RYKRLLENQ-------------KSQEEKELELSLNKVEDILVPVAEDLQSYFKDESKHPIQKRKT 283

  Fly   227 N--FQCPECEFHAKFPKPYKEHLQKEHGLQRPRIYP-----CTLCIKTFGVLKTLKNHLRDTHSR 284
            :  .:||.|..:..|...::.|:.|.   :|.|:|.     |:.|.::|...|.|:.|  ....|
  Fly   284 SSLSKCPSCAQNYGFSFSHQLHMVKH---RRERLYTNFPFHCSFCNRSFLTRKFLRKH--QQRVR 343

  Fly   285 TFESEAKTKAKESKEKEAKSGAKNKIDAKAKETNAVSQRKKP----KEKKSK---EKKTEIKCN- 341
            || |....:..:......:...|:.:|:....   :.:|:||    |...|:   ...|..:|| 
  Fly   344 TF-STLLYRPFKCPHCTWRFQLKSALDSHVLR---IHERRKPCLICKLPTSRLCCSAHTSKECNR 404

  Fly   342 VETKVVDEIDDQVNNKKGTDSEDADQTQATKIASFKALNESLMKKRMLENVIDSEYTFAINGSSA 406
            ...|..|::.......||     ..:.|.|.:.  |..|....:|..||..::..:         
  Fly   405 AMQKYRDKMRPLREPPKG-----GCRKQPTPVC--KICNRKFTRKFFLEEHMNKAH--------- 453

  Fly   407 STPRADSNNFQCEICDCELMTAKQMQEHMKTVHSIDKPKVFKCHVCEKSLATKQSLKTH--MTLH 469
                .:..||.||||.....:...||.|.|.||.:  ....:|.||:.::.:|.:.:.|  ...|
  Fly   454 ----LNKRNFTCEICGANFYSQGTMQTHRKAVHLL--VHTVQCEVCDLTIKSKGNYRRHCKSQSH 512

  Fly   470 ADGA--------EAPNSSKRKILQDEDEDVDILGTTQIENTAEKVEGPKKSQQSPTKAAKFT-NR 525
            .|..        :..:|::||..:..||.:||             |....:....|.|.|.| |.
  Fly   513 KDNLVKFGKNNDKTKDSNRRKGARTTDEKLDI-------------EASSSTNTCMTSANKSTHNY 564

  Fly   526 KILQEEDEVVEIVDAFKTDNTAEDDEGPAEEKIIRSRNNIQHQVDGGMIAPRSPAKKTKKTSHVD 590
            |.:           ..||..|                    |.        ::|.:..|:   |.
  Fly   565 KKM-----------GIKTKQT--------------------HL--------KTPCRSKKR---VK 587

  Fly   591 LSVSTTNGNSPAKSEKR 607
            :.:..|.|||...|.:|
  Fly   588 IKICETCGNSIVGSMQR 604

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2199NP_728599.1 C2H2 Zn finger 418..439 CDD:275370 8/20 (40%)
C2H2 Zn finger 449..469 CDD:275370 5/21 (24%)
CG8089NP_611014.1 C2H2 Zn finger 289..309 CDD:275368 5/19 (26%)
C2H2 Zn finger 322..343 CDD:275368 6/22 (27%)
C2H2 Zn finger 355..376 CDD:275368 2/23 (9%)
C2H2 Zn finger 432..453 CDD:275368 5/22 (23%)
C2H2 Zn finger 461..486 CDD:275368 10/26 (38%)
C2H2 Zn finger 490..506 CDD:275368 4/15 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440010
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.