DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2199 and CG12942

DIOPT Version :9

Sequence 1:NP_728599.1 Gene:CG2199 / 38159 FlyBaseID:FBgn0035213 Length:733 Species:Drosophila melanogaster
Sequence 2:NP_610628.2 Gene:CG12942 / 36158 FlyBaseID:FBgn0033569 Length:686 Species:Drosophila melanogaster


Alignment Length:672 Identity:134/672 - (19%)
Similarity:226/672 - (33%) Gaps:193/672 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 DKKAV----KVP--KKNTTLRQRSKSIAAFPPSFVNGANTNTEIEIISAS----PKKLD------ 158
            |:|.|    :||  :|..|..|..|..            ||.::.:||..    |.::.      
  Fly    29 DRKTVQLNAEVPNLQKTRTYAQSLKQC------------TNLDLRVISPGGYLWPMQICVRCCRA 81

  Fly   159 -KTPKKQISRLFEDNLN-----DSVKL-TPAKEVSSTKKAFLNLFGNGGNDAIEVLTESEEEEDS 216
             :.....:....|.||.     .|||| :|..|:.  :||                  |.|    
  Fly    82 LEVAMHFVEMALESNLKLQAEAKSVKLPSPTGELK--RKA------------------SNE---- 122

  Fly   217 DKGPITINTNNFQCPECEFHAKFPKPYKEHLQKEHGLQRPRIYPCTLCIKTFGVLKTLKNHLRDT 281
                 ||..|.|.....:|...:..|.:|::....|.:.||:          .|..:..:.....
  Fly   123 -----TIPWNQFSQEFEQFVEGYEGPIEENVLYMRGTKVPRL----------DVDASSSSETAPK 172

  Fly   282 HSRTFESEAKTKAKESKEKEAKSGAKNKIDAKAKET---NAVSQRKKPKEKKSKEKKTEIKCNVE 343
            .......:.|....:.:|::...|:    |||..||   |:::..:........||..|...|. 
  Fly   173 EDEVILFDVKYDTNDLEEEDENDGS----DAKNNETFFENSITPGESVMVVSVAEKAVENNNNY- 232

  Fly   344 TKVVDEIDDQVNNKKG--TDSEDADQTQATKIASFKALNESLMKKRMLENVIDSEYTFAINGSSA 406
                     ..|||.|  || |:.|..|                 |.||..::.:      |.|.
  Fly   233 ---------NFNNKNGDVTD-EECDLIQ-----------------RALEMTLNDD------GCSQ 264

  Fly   407 STPRADSNNFQCEICDCELMTAK--QMQEHMKTVHSIDKPKVFKCHVCEKSLATKQSLKTHMTLH 469
            |.....||..|.:....|:.:..  ::.....|..:|   .:.||::|:.:....:.||.|.   
  Fly   265 SPKNEASNETQLKSNGIEVSSPLFIKLATTSSTTGNI---PILKCNICQYTHTDAEQLKIHY--- 323

  Fly   470 ADGAEAPNSSKRKILQDEDEDVDILGTTQIENTAEKVEGPKKSQQSPTKAAKFTNRKILQEEDEV 534
                    .|..||...||   ||:|..:.:|          .:..|..:.:..:|..:|:    
  Fly   324 --------KSIHKISMMED---DIIGLNKNQN----------FKCRPCNSYETKDRSEMQK---- 363

  Fly   535 VEIVDAFKTDNTAE-----DDEGPAEEKIIRSRNNIQHQVDGGMIAPRSPAKK-TKKTSHVDLSV 593
             .::|..|.|...|     ....||.::|.:.:              ||..|. |:..:.|.::|
  Fly   364 -HLIDHHKIDGDFEMYCYMQANCPACDRIFKDQ--------------RSARKHYTRVHTPVQIAV 413

  Fly   594 STTNG----------NSPAKSEKRKKQDKSEDTLPSSDVDIVEEINYNVRPHKKARLESIGDSTA 648
            |.|..          |..|.....::..:.:|.:..|..|  ::.| ::|.: :..|:.:   .|
  Fly   414 SPTESYACTACDKVFNQKASLHSHQRFCQVKDVVHCSFCD--QQFN-SMRKY-ELHLQQL---HA 471

  Fly   649 DESTLSCDRCGKFVKSRQRLDSHMEKKHAAKLQCTLCKEVYQNQMDYVAHF--SNCGSEGGLPCG 711
            .|:...|:.|.:..||.:.|..|.::......||..|...|.|..:...|:  ::...|   |..
  Fly   472 VETVHECEICRRSFKSAETLTMHRKRHSERHYQCGKCSLNYVNSAELRVHYERAHVNEE---PVS 533

  Fly   712 VANCKKVFTEANFLSSHLRKRH 733
            ...|...|.....|..|.::.|
  Fly   534 CLTCGNQFQNMTLLREHEQRSH 555

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2199NP_728599.1 C2H2 Zn finger 418..439 CDD:275370 2/22 (9%)
C2H2 Zn finger 449..469 CDD:275370 5/19 (26%)
CG12942NP_610628.2 zf-AD 22..101 CDD:285071 17/83 (20%)
C2H2 Zn finger 385..406 CDD:275368 7/34 (21%)
C2H2 Zn finger 421..470 CDD:275368 8/55 (15%)
C2H2 Zn finger 449..466 CDD:275371 4/20 (20%)
C2H2 Zn finger 478..498 CDD:275368 6/19 (32%)
C2H2 Zn finger 505..526 CDD:275368 5/20 (25%)
C2H2 Zn finger 534..555 CDD:275368 4/20 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440078
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.