DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2199 and CG30020

DIOPT Version :9

Sequence 1:NP_728599.1 Gene:CG2199 / 38159 FlyBaseID:FBgn0035213 Length:733 Species:Drosophila melanogaster
Sequence 2:NP_610627.2 Gene:CG30020 / 36156 FlyBaseID:FBgn0050020 Length:1309 Species:Drosophila melanogaster


Alignment Length:790 Identity:147/790 - (18%)
Similarity:256/790 - (32%) Gaps:200/790 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 VLET-------ITHRSIPSSLPIKICFVCTSTFMSSAALIEKVRETV---------DRVQEQPAK 94
            ||||       :.|:.:|..:........|||.::.:..|..|.:..         ..:...||.
  Fly   512 VLETQAPLPQPVVHQPMPDPMQQTEPMATTSTTITESGDINVVVDATPLFYAATSNSLLVTNPAP 576

  Fly    95 KTKVAEIEEPSTQESDKKAVKVPKKNTTLRQ-------RSKSIAAF--PPSFVNGANTNTEIEII 150
            .|.|.|....::..:.....::.:.|..:.:       .|.|::.|  ...|::    ||::..|
  Fly   577 VTTVEETTGTASNHAFGIFPEISEGNLPVNEAVQQAPANSSSVSVFGDMQDFID----NTDVAAI 637

  Fly   151 SASPKKLDKTPKKQISRLFEDNLNDSVKLTPAKEVSSTKKAFLNLFGNGGNDAIEVLTESEEEED 215
            ...|  .|..|......:..||.|.|:.....           |||.:...:..:.:.:.|:|.|
  Fly   638 CTIP--ADGMPVVDGDDIVIDNNNISLDFDAE-----------NLFEDFEEEEDDTVADEEDEAD 689

  Fly   216 SDKGPITINTNN---------------------------FQCPECEF-HAKFPKPYK--EHLQKE 250
            ::..    |.||                           .|.|.|.: :.||...||  .|:...
  Fly   690 NEDE----NDNNDAATDQNLLLTSDDDDVDDFDDEQSKHLQKPYCIYCNKKFTSQYKFENHMFVH 750

  Fly   251 HGLQRPRIYPCTLCIKTFGVLKTLKNHLRDTHSRTFESEAKTKAKESKEKEAKSGAKNKIDAKAK 315
            .||..   |.|.||...:.:.:.|..|.:..|.| ..:....:||..|...|::..:.....:.|
  Fly   751 RGLAP---YRCELCTNLYNMKRLLIKHYKTVHKR-MPTRDMVQAKGDKVSVARTNIEKLYPGRIK 811

  Fly   316 ETNAVSQRKKPKEKKSKEKKTEIKCNVETKVVDEIDDQVNNKKGTD---SEDADQTQATK----- 372
            ....:.                .||..|.:...|:...:|...|.:   ||.|::....:     
  Fly   812 NPMLMC----------------AKCPFECESDSEMRKHLNAHHGINDGVSEHANEVFIIRKLPFE 860

  Fly   373 ----IASFKA---LNESLMKKRMLENVIDSEYTFAINGSSASTPRADSNNFQCEICDCELMTAKQ 430
                |.||.|   |:..|.:..:::.:|:.:....  |.:.:|..|.|::...|..: .:....|
  Fly   861 CPRCIRSFAAKTTLSRHLQRSHLVDTIIEMQTPHC--GEAITTTMATSSSTISEPVN-SVTVDGQ 922

  Fly   431 MQEHMKTVHSIDKPKVFKCHVCEKSLATKQSLKTHMTLHADGAEAPNS-------SKRKILQDED 488
            ..|.|:|....:|                   .|....:.||.|...:       ::..:.::|.
  Fly   923 HNEMMQTDVGAEK-------------------MTEALGNGDGNEEGGTDDGTGVKAEPAVPEEEL 968

  Fly   489 EDVDILGTTQIENTA------EKVEGPKKSQQSP--TKAAKFTNRKILQEEDEVVEIVDAFKTDN 545
            :.|.:...|.:..||      ........|.:||  |.|:..|.               .|.|..
  Fly   969 DPVTLDAATAVTTTAIAAAISAAAAATATSLESPVATTASSSTT---------------LFPTPT 1018

  Fly   546 TAEDDEGPAEEKIIRSRNNIQHQVDGGM---IAPRSPAKKTKKTSHVDLSVSTTNGNSPAKSEKR 607
            ..:.|.....::..:|..|| |.|...:   .:...|..::.|     |..:|....||||..  
  Fly  1019 PFDFDYDIMRDEAQQSSPNI-HDVSKALSDNASSSCPINESYK-----LLSTTALETSPAKGL-- 1075

  Fly   608 KKQDKSEDTLPSSDVDIVEEINYNVRPHKKARLESIGDSTADESTL-------------SCDRCG 659
                :|...|..|.:.|.:..|..        .:.:|.....|..|             .|..|.
  Fly  1076 ----RSNSRLHRSSIHICKLCNQT--------FDELGKLVKHEMELHSNTERSRWGYQHKCAICN 1128

  Fly   660 KFVKSRQRLDSHMEKKHAAKLQCTLCKEVYQNQMDYVAHF-SNCGSEGGLPCGVANCKKVFTEAN 723
            ...::...|..||::....|.||.||.:.:....:...|. :....:..|.|.:..|:|.|...:
  Fly  1129 TSYRTLTLLKFHMKRHSNRKSQCKLCPKSFVTIAELERHTKAKHSKDKTLRCFMDGCRKTFAFKH 1193

  Fly   724 FLSSHLRKRH 733
            .|..|.:..|
  Fly  1194 HLIRHQKASH 1203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2199NP_728599.1 C2H2 Zn finger 418..439 CDD:275370 5/20 (25%)
C2H2 Zn finger 449..469 CDD:275370 1/19 (5%)
CG30020NP_610627.2 zf-AD 25..106 CDD:285071
C2H2 Zn finger 369..389 CDD:275368
C2H2 Zn finger 397..418 CDD:275368
C2H2 Zn finger 442..460 CDD:275368
C2H2 Zn finger 730..750 CDD:275368 6/19 (32%)
C2H2 Zn finger 758..777 CDD:275368 5/18 (28%)
C2H2 Zn finger 1089..1110 CDD:275368 3/28 (11%)
C2H2 Zn finger 1124..1144 CDD:275368 5/19 (26%)
C2H2 Zn finger 1151..1172 CDD:275368 4/20 (20%)
C2H2 Zn finger 1180..1203 CDD:275368 6/22 (27%)
C2H2 Zn finger 1210..1230 CDD:275368
C2H2 Zn finger 1238..1254 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457888
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.