DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2199 and az2

DIOPT Version :9

Sequence 1:NP_728599.1 Gene:CG2199 / 38159 FlyBaseID:FBgn0035213 Length:733 Species:Drosophila melanogaster
Sequence 2:NP_610289.2 Gene:az2 / 35682 FlyBaseID:FBgn0025185 Length:593 Species:Drosophila melanogaster


Alignment Length:715 Identity:118/715 - (16%)
Similarity:214/715 - (29%) Gaps:249/715 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 TSTFMSSAALIEKVRETVDRVQEQPA-------------------KKTKVAEIEEPSTQESDKKA 113
            ||..:|||...|:|......:.|:|.                   :.|...|.||....|.|..:
  Fly    58 TSEVISSAKCEEEVSPAKVFIVEEPPENCLAEDMFVDVPPSSENDESTSPVEEEEEEDDEVDSSS 122

  Fly   114 VKVP----KKNTTLRQRSKSIAAFPPSFVNGANTNTE-IEIISASPKKLDKTPKKQISRLFEDNL 173
            :.|.    .:|:|   ....:..|.|:|...:...|: ||:.            ||.:.|::   
  Fly   123 MTVDCELGTRNST---HFAPLTKFNPTFYRRSPRITQFIELY------------KQQTCLWD--- 169

  Fly   174 NDSVKLTPAKEVSSTKKAFLNLFGNGGNDAIEVLTESEEEEDSDKGPITINTNNFQCPEC--EFH 236
                   ||.|....|:...|.:              ||..:..|..:.::...::..:|  ..|
  Fly   170 -------PADESYRDKEKRANAY--------------EELLEQLKATVNLHLTAYKLKKCITSLH 213

  Fly   237 AKFPKPYKEHLQKEHGLQRPRIYPCTLCIKTFGVLKTL--KNHLRDTHSRTFESEAKTKAKESKE 299
            |::....::  :|...|.:..:|       ..|....|  :..|.|..|...:.:.|.|...::|
  Fly   214 AQYASISRQ--KKTQKLTKVPLY-------YHGKYSFLAERGSLEDADSDDVDGDGKIKLVFTEE 269

  Fly   300 KEAKSGAKNKIDAKAKETNAVSQRKKPKEKKSKEKKTEIKCNVETK------VVDEIDDQVNNKK 358
            .:..:   ..||..:|    ..|...|..|..        ||:..:      :.|.:..:.:...
  Fly   270 NQLTT---QFIDLYSK----FPQLYDPAHKHF--------CNLNVRKSSLIEITDLLTSEFSLGL 319

  Fly   359 GTDSEDADQTQATK---------IASFKALNESLMKKRMLENVIDSEYTFAINGSSASTPRADSN 414
            .|..:..|..|:.:         :...:.:..||.:|:.:|..           :|....::...
  Fly   320 VTHYDVYDSIQSMRQWYSRRIKTLTDVQCVGLSLAEKQYIERC-----------NSFMPTKSFRQ 373

  Fly   415 NFQCEICDCELMTAKQMQEHMKTVHSIDKPKVFKCHVCEKSLATKQSLKTHMTLHADGAEAPNSS 479
            ..:||:|:....|...:|.|....|.:.....|:|.:||.:...|..|:.|              
  Fly   374 KLKCEVCEHSFSTDHALQAHQFRDHKMGDGGWFRCTLCELNFDRKCHLQQH-------------- 424

  Fly   480 KRKILQDEDEDVDILGTTQIENTAEKVEGPKKSQQSPTKAAKFTNRKILQEEDEVVEIVD-AFKT 543
                                                        ::::..::..|.||.. :|..
  Fly   425 --------------------------------------------SQRVHMDKSFVCEICSRSFAF 445

  Fly   544 DNTAEDDEGPAEEKIIRSRNNIQHQVDGGMIAP---RSPAKKTKKTSHVDLSVSTTNGNSPAKSE 605
            .|          :..|..|.:.:..|....:..   :...:|.:.|:||                
  Fly   446 GN----------QLAIHKRTHDEKHVAKPFVCEFCGKCFKQKIQMTTHV---------------- 484

  Fly   606 KRKKQDKSEDTLPSSDVDIVEEINYNVRPHKKARLESIGDSTADESTLSCDRCGKFVKSRQRLDS 670
                                      ...|.|.|            ...||.|.|...:::.|..
  Fly   485 --------------------------TAVHTKIR------------AFKCDMCPKDFLTKRDLKD 511

  Fly   671 HMEKKH--AAKLQCTLCKEVYQNQMDYVAHFSNCGSEGGLPCGVANCKKVFTEANFLSSHLRKRH 733
            |: |.|  .....|.:|::.:.|....|.| .:...|..|.|.:  |...|:|...|..|:|:.|
  Fly   512 HV-KAHLNIRDKVCEVCQKAFTNANALVKH-RHIHKEKTLQCSL--CTTRFSERVSLGVHMRRTH 572

  Fly   734  733
              Fly   573  572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2199NP_728599.1 C2H2 Zn finger 418..439 CDD:275370 6/20 (30%)
C2H2 Zn finger 449..469 CDD:275370 6/19 (32%)
az2NP_610289.2 MADF_DNA_bdg 157..242 CDD:287510 20/129 (16%)
GT1 276..>341 CDD:304916 12/76 (16%)
C2H2 Zn finger 377..398 CDD:275368 6/20 (30%)
C2H2 Zn finger 408..429 CDD:275368 6/78 (8%)
C2H2 Zn finger 436..456 CDD:275368 6/29 (21%)
C2H2 Zn finger 467..488 CDD:275368 4/62 (6%)
C2H2 Zn finger 496..516 CDD:275368 7/20 (35%)
C2H2 Zn finger 524..544 CDD:275368 5/20 (25%)
C2H2 Zn finger 551..572 CDD:275368 7/22 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457885
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.