DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2199 and CG12299

DIOPT Version :9

Sequence 1:NP_728599.1 Gene:CG2199 / 38159 FlyBaseID:FBgn0035213 Length:733 Species:Drosophila melanogaster
Sequence 2:NP_609448.1 Gene:CG12299 / 34483 FlyBaseID:FBgn0032295 Length:736 Species:Drosophila melanogaster


Alignment Length:753 Identity:146/753 - (19%)
Similarity:253/753 - (33%) Gaps:229/753 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 CFVCTSTFMSSAALIEKVRE-------TVDRVQEQPAKKTK--------VAEIEEPSTQESDKKA 113
            |..|...|:...||.:.:..       ...:.||.|..:::        |.|:.|..:..||..|
  Fly    50 CMCCAEFFVHPLALYQHMNTLHPHEPGNGQQEQESPGDESEDYSWIFEPVCELAEDGSDSSDGSA 114

  Fly   114 VK------------------VPKKNTTLRQRSKSIAAFPPSFVNGANTNTEIEIISASPK----- 155
            ..                  ....:::....|.|.::.|.:    :|:||:....|..|.     
  Fly   115 SSGSDSSSSSDDDDDDDDDDSSSSSSSSSNSSSSSSSVPTT----SNSNTQQSQESVQPLHGLVA 175

  Fly   156 -------KLDKTPKKQISRLFEDNLNDSVKLTPAKEV---SSTKKAFLNL--------FGNGGND 202
                   :|..|..::.:.:|  .:..:|.:||.:::   :.|....|.|        .|...|.
  Fly   176 GPGYNEFQLQMTDPRESTSIF--MVQPTVSVTPLQQLLPPAPTVSPGLGLQSTPIKRRRGRRSNI 238

  Fly   203 AIEVLTESEEEEDSDKGPITINTNN--FQCPECEFHAKFPK--PYKEHLQKEHGLQRPRIYPCTL 263
            ...|:..:            :|.|.  |||..||  |.||.  ...:|: :.|...:|  :.|::
  Fly   239 GAPVMDPA------------LNGNQKCFQCTHCE--ASFPNAGDLSKHV-RSHITNKP--FQCSI 286

  Fly   264 CIKTFGVLKTLKNHLRDTHS--RTFESEAKTKAKESKEKEAKSGAKNKIDAKAKETNAVSQRKKP 326
            |.|||..:.:|..|:| .||  :.::.|...||.............:.:             :||
  Fly   287 CQKTFTHIGSLNTHIR-IHSGEKPYKCELCPKAFTQSSSLMVHMRSHSV-------------RKP 337

  Fly   327 KEKKSKEK------------KTEIKCNVETKVVDEIDDQVNNKKGTDSEDADQTQ------ATKI 373
            .:....:|            ||.| ...||.:..|.:.:...:...|......||      |...
  Fly   338 HQCVQCDKGFINYSSLLLHQKTHI-APTETFICPECEREFKAEALLDEHMRMHTQELVYQCAICR 401

  Fly   374 ASFKALNESL--MKKRMLENVID---SEYTFAINGSSASTPRADSNN--FQCEICDCELMTAKQM 431
            .:|:|.:|.:  ||..|.|....   .:.:|..:||.....|..:..  |||::||.....|..:
  Fly   402 EAFRASSELVQHMKNHMGEKPFTCSLCDRSFTQSGSLNIHMRIHTGEKPFQCKLCDKCFTQASSL 466

  Fly   432 QEHMKTVHSIDKPKVFKCHVCEKSLATKQSLKTHMTLH--ADGAEAPNSSKRKILQDEDEDV--D 492
            ..||| :|:.:||  :.|.:|.||.:.:..|..|:..|  |..|.|..|....:.:...|.:  .
  Fly   467 SVHMK-IHAGEKP--YPCPICGKSYSQQAYLNKHIQAHQMASAASASTSPGLLVAKQPHETLVCI 528

  Fly   493 ILGTTQIENTA-------------------------------------------EKV-------- 506
            :.|:...:.||                                           |:|        
  Fly   529 VCGSLHADATALASHVHSQHAALLDTMKQSGMNTAPGGAIPDVKCSAEEQQAYVERVQCVLQQMN 593

  Fly   507 ----------EGPKKSQQSPTKAAKFTNRKILQEEDEVVEIVDAFK---TDNTAEDDEGPAEEKI 558
                      :.|::.||.|.:    ..::.||::...:::....|   .|:|.||:|.|.|.:.
  Fly   594 HQQQHQQHQQQPPQQQQQHPQQ----QQQQHLQQQPHQMQLPQQPKLPAMDSTGEDEEEPDEAEE 654

  Fly   559 IRSRNNIQHQVDGGMIAPRSPAK-KTKKTSHVDLSVSTTNGNSPAKSEKRKK----QDKSEDTLP 618
            .......|.:       |..||: ||:..:..|   :.||...|....:.::    .|...:...
  Fly   655 PPDEEEEQDE-------PEEPAEVKTEVLAAED---ALTNPGYPILGLQEEQILLDSDMYYEDFG 709

  Fly   619 SSDVDIVEEINYNVRPHKKARLESIGDSTADESTLSCD 656
            ..||...||:              .||...:|..:..|
  Fly   710 DMDVGCQEEV--------------FGDFVVNEEEVYTD 733

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2199NP_728599.1 C2H2 Zn finger 418..439 CDD:275370 7/20 (35%)
C2H2 Zn finger 449..469 CDD:275370 6/19 (32%)
CG12299NP_609448.1 COG5048 <254..413 CDD:227381 40/178 (22%)
C2H2 Zn finger 256..276 CDD:275368 7/22 (32%)
zf-H2C2_2 268..293 CDD:290200 8/27 (30%)
C2H2 Zn finger 284..304 CDD:275368 8/20 (40%)
zf-H2C2_2 296..321 CDD:290200 8/25 (32%)
zf-C2H2_2 312..>387 CDD:289522 13/88 (15%)
C2H2 Zn finger 312..332 CDD:275368 3/19 (16%)
C2H2 Zn finger 340..360 CDD:275368 2/19 (11%)
C2H2 Zn finger 369..389 CDD:275368 2/19 (11%)
C2H2 Zn finger 397..417 CDD:275368 6/19 (32%)
zf-H2C2_2 409..434 CDD:290200 6/24 (25%)
C2H2 Zn finger 425..445 CDD:275368 4/19 (21%)
zf-H2C2_2 437..462 CDD:290200 7/24 (29%)
C2H2 Zn finger 453..473 CDD:275368 7/20 (35%)
zf-H2C2_2 465..490 CDD:290200 10/27 (37%)
C2H2 Zn finger 481..501 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.