DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2199 and CG3032

DIOPT Version :9

Sequence 1:NP_728599.1 Gene:CG2199 / 38159 FlyBaseID:FBgn0035213 Length:733 Species:Drosophila melanogaster
Sequence 2:NP_001284974.1 Gene:CG3032 / 31648 FlyBaseID:FBgn0029928 Length:431 Species:Drosophila melanogaster


Alignment Length:494 Identity:90/494 - (18%)
Similarity:166/494 - (33%) Gaps:122/494 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLCENMTKVQKEVRCDHCGTSQGSKSVFSGQKVFLGRKITDVLETITHRSIPSS------LPIKI 63
            |.|..:.:::||          ..|:.....::.:.:::..:|.....:.:.:.      ||.::
  Fly    13 LCCTCLLQLEKE----------PLKTELQSDEIPISQELQQLLNINLSQDVENQDADQQWLPNEL 67

  Fly    64 CFVCTSTFMSSAALIEKVRETVDRVQEQPAKKTKVAEIEEPSTQ------ESDKKAVKVPKKNTT 122
            |..|.|...:    .||.|...|..::|..:..| .:..||:.:      |.|::::.       
  Fly    68 CLECRSAVQN----FEKFRRKADECRKQLLEMLK-KDPREPTFEVVYDGREEDQESLH------- 120

  Fly   123 LRQRSKSIAAFPPSFVNGANTNTEIEIISASPKKLDKTPKKQISRLFEDNLNDSVKLTPAKEVSS 187
                    ...||......:...|..|      |.||:|:|.    |..:.|       ..:.|.
  Fly   121 --------GLEPPEPAPDPDPIDEPAI------KSDKSPRKS----FRGSRN-------TLKCSV 160

  Fly   188 TKKAFLNLFGNGGNDAIEVLTESEEEEDSDKGPITINTNNFQCPECEFHAKFPKPYKEHLQKEHG 252
            .:::|.:        .|.:.....:..:..|.|       |||.:||....|......|:::.|.
  Fly   161 CRRSFAH--------QITLAAHIRKVHEGSKRP-------FQCDQCEKAYSFMGGLYTHIREVHA 210

  Fly   253 LQRPRIYPCTL--CIKTFGVLKTLKNHLRDTHSRTFESEAKTKAKESKEKEAKSGAKNKIDAKAK 315
             .:.|.:||..  |.:.:.....::.|.|..||.......|....|.........|..|...|.|
  Fly   211 -PKERRHPCDQPGCERIYTSRIAMQKHKRLKHSPRDRDALKKFICEQCGASFNQSANLKYHLKTK 274

  Fly   316 ---ETNAVSQRKKPKEKK-----SKEKKTEIKCNVETKVVDEIDDQVNNKKGTDSEDADQTQATK 372
               |....::.....|:.     .||..:.......|....|:.:::.:    :.:...:..|.|
  Fly   275 HPTEDEVAAREGGAGERHFCDICQKEFHSRYTLKYHTLQQHEVQEELPH----ECQVCGRRMAKK 335

  Fly   373 IASFKALNESLMKKRMLENVIDSEYTFAINGSSASTPRADSNNFQCEICDCELMTAKQMQEHMKT 437
               |..|...||.                          .::...||.|........:::.|::.
  Fly   336 ---FMLLQHMLMH--------------------------SNDKLPCEHCGRRFARRFELEAHVRA 371

  Fly   438 VHSIDKPKVFKCHVCEKSLATKQSLKTHMTLHADGAEAP 476
            ||.  |.|.|.||.|.:|.|::::|:.|..:|.  .|.|
  Fly   372 VHL--KLKPFPCHHCPESFASRKTLRHHEYIHT--GEKP 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2199NP_728599.1 C2H2 Zn finger 418..439 CDD:275370 4/20 (20%)
C2H2 Zn finger 449..469 CDD:275370 7/19 (37%)
CG3032NP_001284974.1 zf-AD 13..95 CDD:285071 16/95 (17%)
C2H2 Zn finger 158..179 CDD:275368 3/28 (11%)
C2H2 Zn finger 188..209 CDD:275368 5/20 (25%)
C2H2 Zn finger 218..239 CDD:275368 3/20 (15%)
C2H2 Zn finger 254..275 CDD:275368 4/20 (20%)
C2H2 Zn finger 294..315 CDD:275368 3/20 (15%)
C2H2 Zn finger 325..345 CDD:275368 5/22 (23%)
C2H2 Zn finger 352..373 CDD:275368 4/20 (20%)
C2H2 Zn finger 381..401 CDD:275368 7/19 (37%)
C2H2 Zn finger 409..429 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440020
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.