DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2199 and Zfp764

DIOPT Version :9

Sequence 1:NP_728599.1 Gene:CG2199 / 38159 FlyBaseID:FBgn0035213 Length:733 Species:Drosophila melanogaster
Sequence 2:NP_666315.3 Gene:Zfp764 / 233893 MGIID:2443580 Length:431 Species:Mus musculus


Alignment Length:421 Identity:81/421 - (19%)
Similarity:138/421 - (32%) Gaps:142/421 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 LTPA-----KEVSSTKKAFLNLFGNGGNDAIEVLTESEEEEDSDKGPITINTNNFQC-----PEC 233
            |.||     :||.......|...|.||  |...|....|||....||...:.....|     .:|
Mouse    39 LRPAQRALYREVMRETYGLLASLGLGG--AKPALICWVEEESEVWGPCAQDPEVAMCRTEVHSDC 101

  Fly   234 --EFHAKFPKPYKEHLQK----EHGLQRPRI-------------------YPCTLCIKTFGVLKT 273
              |...|.|:...|.:||    |.|.:.|::                   :.|.||.|:|....|
Mouse   102 RHEKERKRPREETEAMQKTFSPEPGQKEPQLSFAGSASGIQATVLRADKRHGCHLCGKSFAQRPT 166

  Fly   274 LKNHLRDTHSRTFESEAKTKAKESKEKEAKSGAKNKIDAKAKET---NAVSQRKKPKE----KKS 331
            |..||. ||              :.||..:....||...:|...   .|:.:.::|.:    .||
Mouse   167 LVEHLY-TH--------------TGEKPFQCPDCNKCFGRASSLTMHRAIHRGERPHQCPDCGKS 216

  Fly   332 KEKKTEIKCNVETKVVDEIDDQVNNKKGTDSEDADQ--TQATKIASFKALN-------------- 380
            ..:::.:..::.|.         ..:|.....|.::  ::::.::|.:|::              
Mouse   217 FTQRSTLVAHMYTH---------TGEKPFCCPDCNKSFSRSSSLSSHRAIHRGERPHCCPDCGRA 272

  Fly   381 ---ESLMKKRMLENVIDSEYTFAING----------------SSASTPRADSNNFQCEICDCELM 426
               .|.:...:..:..:..|..|..|                .|..||      |.|..|.....
Mouse   273 FTRRSGLIAHLRIHTGEKPYCCADCGRCFSQRSAFREHQRVVHSGVTP------FTCTHCGRAFA 331

  Fly   427 TAKQMQEHMKTVHSIDKP--------------------------KVFKCHVCEKSLATKQSLKTH 465
            .:|.::.||: :|:.:||                          :.:.|..|.:...||.::.:|
Mouse   332 DSKYLRRHMR-IHTGEKPYSCPDCGRCFRQSSEIPAHRRTHTGERPYPCPQCGRQFRTKSAMTSH 395

  Fly   466 MTLHADGAEAPNSSKRKIL------QDEDED 490
            ..:|..||:.....|.:.|      :.||.|
Mouse   396 QWVHRPGAKGHKDKKARQLSISLDPRQEDPD 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2199NP_728599.1 C2H2 Zn finger 418..439 CDD:275370 5/20 (25%)
C2H2 Zn finger 449..469 CDD:275370 5/19 (26%)
Zfp764NP_666315.3 KRAB 22..81 CDD:214630 14/43 (33%)
KRAB 22..55 CDD:279668 5/15 (33%)
C2H2 Zn finger 154..174 CDD:275368 9/20 (45%)
zf-H2C2_2 167..191 CDD:290200 9/38 (24%)
COG5048 178..>243 CDD:227381 11/73 (15%)
C2H2 Zn finger 182..202 CDD:275368 4/19 (21%)
zf-H2C2_2 194..219 CDD:290200 4/24 (17%)
C2H2 Zn finger 210..230 CDD:275368 2/19 (11%)
zf-H2C2_2 223..243 CDD:290200 3/28 (11%)
COG5048 262..>317 CDD:227381 4/54 (7%)
C2H2 Zn finger 266..286 CDD:275368 1/19 (5%)
zf-H2C2_2 282..303 CDD:290200 3/20 (15%)
zf-C2H2 321..343 CDD:278523 6/22 (27%)
C2H2 Zn finger 323..343 CDD:275368 5/20 (25%)
zf-H2C2_2 335..360 CDD:290200 5/25 (20%)
C2H2 Zn finger 351..371 CDD:275368 0/19 (0%)
zf-H2C2_2 367..388 CDD:290200 2/20 (10%)
C2H2 Zn finger 379..399 CDD:275368 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167832253
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.