DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG2199 and ZNF688

DIOPT Version :9

Sequence 1:	NP_728599.1	Gene:	CG2199 / 38159	FlyBaseID:	FBgn0035213	Length:	733	Species:	Drosophila melanogaster
Sequence 2:	XP_024305933.1	Gene:	ZNF688 / 146542	HGNCID:	30489	Length:	384	Species:	Homo sapiens

Alignment Length:	138	Identity:	23/138 - (16%)
Similarity:	47/138 - (34%)	Gaps:	32/138 - (23%)

- Green bases have known domain annotations that are detailed below.

  Fly   354 VNNKKGTDSEDADQTQATKIASFKALNESLMKKRMLENVIDSEYTFAINGSSASTPR-------- 410
            |.|:|..:.|:..:.:..:.|..|...|.|:::       :.:...::..:.|..|:
Human   214 VPNRKEEEPEEVPRAKGPRKAPVKESPEVLVER-------NPDPAISVAPARAQPPKNAAWDPTT 271

  Fly   411 --------------ADSNNFQCEICDCELMTAKQMQEHMKTVHSIDKPKVFKCHVCEKSLATKQS 461
                          |......|..|.........:..| :.:||.::|  |.|..|......|.:
Human   272 GAQPPAPIPSMDAQAGQRRHVCTDCGRRFTYPSLLVSH-RRMHSGERP--FPCPECGMRFKRKFA 333

  Fly   462 LKTHMTLH 469
            ::.|..:|
Human   334 VEAHQWIH 341

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG2199	NP_728599.1	C2H2 Zn finger	418..439	CDD:275370	3/20 (15%)
CG2199	NP_728599.1	C2H2 Zn finger	449..469	CDD:275370	4/19 (21%)
ZNF688	XP_024305933.1	KRAB	171..212	CDD:307490
		Zn-ribbon_8	<251..>318	CDD:321291	8/67 (12%)
		zf-C2H2	291..313	CDD:306579	3/22 (14%)
		C2H2 Zn finger	293..313	CDD:275368	3/20 (15%)
		zf-H2C2_2	306..330	CDD:316026	7/26 (27%)
		C2H2 Zn finger	321..341	CDD:275368	4/19 (21%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165142453
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.930