DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2199 and Zfp764

DIOPT Version :9

Sequence 1:NP_728599.1 Gene:CG2199 / 38159 FlyBaseID:FBgn0035213 Length:733 Species:Drosophila melanogaster
Sequence 2:XP_006230431.1 Gene:Zfp764 / 102553866 RGDID:7540019 Length:461 Species:Rattus norvegicus


Alignment Length:508 Identity:80/508 - (15%)
Similarity:140/508 - (27%) Gaps:217/508 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 YKEHLQKEHGLQRPRIYPCTLCIKTFGVLKTLKNHLRDTHSRTF---ESEAKTKAKESKEKEAKS 304
            |:|.:::.:||           :.:||:        |.......   |.|.:.....:::.|. :
  Rat    47 YREVMRETYGL-----------LGSFGI--------RGAKPALICWVEEETELWGPRAQDPEV-A 91

  Fly   305 GAKNKIDAKAKETNAVSQRKKPKEKKSKEKKTEIKCNVETKVVDEIDDQVNNKKGTD-------- 361
            ..|.::.:..::.   .:|:||:|:....::|             ...:...|:...        
  Rat    92 MCKTEVHSDCRQE---EKRRKPREETEAIQRT-------------FSTEAGPKEPCPSFAASPSY 140

  Fly   362 ----SEDADQTQATKIASFKALNESLMKKRMLENVIDSEYTFAINGSSASTPRADSNNFQCEICD 422
                |:|..|.|.|     ..|:::::|                         ||..: .|.:|.
  Rat   141 LELLSKDPQQGQPT-----VPLHDTVLK-------------------------ADQRH-GCHVCG 174

  Fly   423 CELMTAKQMQEHMKTVHSIDKPKVFKCHVCEKSLATKQSLKTHMTLHADGAEAPNSSKRKILQDE 487
            .......::.||:.| |:.:||  |:|..|.|......||..|..:|.  .|.|:.         
  Rat   175 KSFTRQSKLVEHLYT-HTGEKP--FQCSECNKCFGRASSLSMHRAIHR--RERPHC--------- 225

  Fly   488 DEDVDILGTTQIENTAEKVEGPKKSQQSPTKAAKFTNRKILQEEDEVVEIVDAFKTDNTAEDDEG 552
                                       .|.....||.|..|                        
  Rat   226 ---------------------------CPDCGKSFTQRSTL------------------------ 239

  Fly   553 PAEEKIIRSRNNIQHQVDGGMIAPRSPAKKTKKTSHVDLSVSTTNGNSPAKSEKRKKQDKSEDTL 617
                        :.|                         :.|..|..|.:.....|    ..:.
  Rat   240 ------------VAH-------------------------MYTHTGEKPFRCPDCNK----SFSW 263

  Fly   618 PSSDVDIVEEINYNVRPHKKARLESIGDSTADESTLSCDRCGKFVKSRQRLDSHM-----EKKHA 677
            ||| :.....|:...|||                  .|..||:....|..|.:|:     ||.:.
  Rat   264 PSS-LSTHRAIHRGERPH------------------CCPDCGRAFTHRSGLITHLRVHTGEKPYC 309

  Fly   678 AKLQCTLCKEVYQNQMDYVAHFSNCGSEGGLPCGVANCKKVFTEANFLSSHLR 730
                |..|...: :|...::........|..|....:|.:.|..|.:|..|:|
  Rat   310 ----CADCGRCF-SQSSGLSEHQRVVHSGMTPFSCTHCGRAFARAAYLRCHMR 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2199NP_728599.1 C2H2 Zn finger 418..439 CDD:275370 5/20 (25%)
C2H2 Zn finger 449..469 CDD:275370 6/19 (32%)
Zfp764XP_006230431.1 KRAB 22..81 CDD:214630 9/52 (17%)
KRAB 22..60 CDD:279668 4/23 (17%)
C2H2 Zn finger 170..190 CDD:275368 5/20 (25%)
zf-H2C2_2 183..207 CDD:290200 10/26 (38%)
C2H2 Zn finger 198..218 CDD:275368 6/19 (32%)
zf-H2C2_2 210..235 CDD:290200 8/62 (13%)
COG5048 <223..383 CDD:227381 37/260 (14%)
C2H2 Zn finger 226..246 CDD:275368 6/80 (8%)
zf-H2C2_2 239..262 CDD:290200 6/87 (7%)
C2H2 Zn finger 254..274 CDD:275368 4/24 (17%)
zf-H2C2_2 266..291 CDD:290200 8/43 (19%)
C2H2 Zn finger 282..302 CDD:275368 6/19 (32%)
zf-H2C2_2 295..319 CDD:290200 6/28 (21%)
C2H2 Zn finger 310..329 CDD:275368 3/19 (16%)
C2H2 Zn finger 339..359 CDD:275368 6/19 (32%)
zf-H2C2_2 351..376 CDD:290200 3/7 (43%)
C2H2 Zn finger 367..387 CDD:275368
zf-H2C2_2 383..402 CDD:290200
C2H2 Zn finger 395..415 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335912
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.