DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2211 and AT5G63080

DIOPT Version :9

Sequence 1:NP_001261251.1 Gene:CG2211 / 38157 FlyBaseID:FBgn0035211 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_201113.2 Gene:AT5G63080 / 836428 AraportID:AT5G63080 Length:462 Species:Arabidopsis thaliana


Alignment Length:253 Identity:47/253 - (18%)
Similarity:84/253 - (33%) Gaps:84/253 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 LTMEEFAP-HAYSSMPIIVKRAVAHWPAQK---------NLS-FA--FIKELYESVPGAMDSDCQ 181
            |:..:||. :...:.|:::......|.|::         ||. ||  |.|...:.      :||.
plant    17 LSYGDFAERYLAKNQPVVISDLTEDWRAREDWVSENGNPNLHVFATHFGKSRVQV------ADCD 75

  Fly   182 FLHFNSDLKSLKHVFSMSAE----RSNLTQGVPWFVGWSVCQ-----------PAVLAELRKLY- 230
            ...| :|.|.|:...:...|    :.::.:.|.:...|...:           |....:...:| 
plant    76 TREF-TDQKRLEMSVTEFVEQWTNKDSIEESVLYLKDWHFVKEYPDYTAYQTPPLFSDDWLNVYL 139

  Fly   231 -------PRPHFLPFDAEMPHTD--FILMGYE-QGAVMHLDYIPRLLWQAQLSGNKTWFLAPAPE 285
                   .|..|..:| ::..:|  |:.||.: ....:|.|......|.|.:.|.|.|...|.|:
plant   140 DNYQMHEDRDSFQKYD-QISCSDYRFVYMGGKGSWTPLHADVFRSYSWSANVCGKKRWLFLPPPQ 203

  Fly   286 -----------CDH--------------------QCQPFSFYVEPGDAVLVDTRIWYH 312
                       |.:                    :|     ..|||:.:.|.:. |:|
plant   204 SHLVYDRYMKNCVYDIFEEVNETKFPGFKKTTWLEC-----IQEPGEIIFVPSG-WHH 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2211NP_001261251.1 cupin_like 133..>306 CDD:304367 43/242 (18%)
AT5G63080NP_201113.2 cupin_like 22..270 CDD:304367 46/248 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 48 1.000 Domainoid score I4498
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12480
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.