DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2211 and PSR

DIOPT Version :9

Sequence 1:NP_001261251.1 Gene:CG2211 / 38157 FlyBaseID:FBgn0035211 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001262832.1 Gene:PSR / 42616 FlyBaseID:FBgn0038948 Length:441 Species:Drosophila melanogaster


Alignment Length:222 Identity:36/222 - (16%)
Similarity:66/222 - (29%) Gaps:70/222 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 PIIVKRAVAHWPAQKNLSFAFIKELYESVPGAMDSDCQFLHFNSDLKSLKHVFSMSAERSNLTQG 208
            |::::.....|.|.:..:.|.:.:.|.:.......|.:  .::..:|...:|..|.:.|.:    
  Fly    74 PVVIRGCTDGWLALEKWTLARLAKKYRNQKFKCGEDNE--GYSVKMKMKYYVEYMQSTRDD---- 132

  Fly   209 VPWFVGWSVCQPAVLAE--------LRKL---YPRPHFLPFD--------AEMPHTDFILMGYEQ 254
                      .|..:.:        .|||   |..|.:...|        ...|:..|::.....
  Fly   133 ----------SPLYIFDSSFGEHHRRRKLLDDYVVPKYFRDDLFQYCGENRRPPYRWFVMGPARS 187

  Fly   255 GAVMHLDYIPRLLWQAQLSGNKTWFLAPA----------------------------------PE 285
            |..:|:|.:....|...:.|:|.|.|.|.                                  |.
  Fly   188 GTGIHIDPLGTSAWNTLIRGHKRWCLFPTQTPKELLKVTSAMGGKQRDEAITWFSTIYPRTQLPS 252

  Fly   286 CDHQCQPFSFYVEPGDAVLVDTRIWYH 312
            ...|.:|.......|:.|.|... |:|
  Fly   253 WPEQYRPIEVLQGAGETVFVPGG-WWH 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2211NP_001261251.1 cupin_like 133..>306 CDD:304367 33/214 (15%)
PSRNP_001262832.1 JmjC 179..293 CDD:202224 18/101 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12480
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.