DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2211 and CG14331

DIOPT Version :9

Sequence 1:NP_001261251.1 Gene:CG2211 / 38157 FlyBaseID:FBgn0035211 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001097824.1 Gene:CG14331 / 42099 FlyBaseID:FBgn0038510 Length:312 Species:Drosophila melanogaster


Alignment Length:299 Identity:95/299 - (31%)
Similarity:143/299 - (47%) Gaps:37/299 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 HNPNRLN--------------------LLW----LLGIVFFIMVATPVFYETISFLLGVRC--FL 99
            |.||.|:                    :.|    |||.:  |::....:||.:.   |..|  :|
  Fly    20 HKPNYLDSTFQELLPNFCKGFLFSEKWVKWIKIVLLGTL--ILLGVKYYYEEMQ---GKNCALYL 79

  Fly   100 PNNYLVWEATRPISDCEFCKGVRAPLILANLTMEEF-APHAYSSMPIIVKRAVAHWPAQKNLSFA 163
            |.|  :..|.||..:|.||..::....|.|::.:|| ...|||:.|:|:..|..:|.|....::.
  Fly    80 PRN--LRYAFRPPENCNFCANIKNVPRLKNISPQEFEKKFAYSAAPVIISDATKNWTAVSLFNYW 142

  Fly   164 FIKELYESVPGAMD-SDCQFLHFNSDLKSLKHVFSMSAERSNLTQG-VPWFVGWSVCQPAVLAEL 226
            :.:::|........ .:||||.:.:....:.....|..:|..|..| .||:.|||.|......|.
  Fly   143 YFRDVYTKAKQKQHIRECQFLPYKTGFLDIYDALDMPEDRVELKPGEQPWYFGWSNCHAETAEEF 207

  Fly   227 RKLYPRPHFLPFDAEMPHTDFILMGYE-QGAVMHLDYIPRLLWQAQLSGNKTWFLAPAPECDHQC 290
            |:.|.||:|||..:|....|:..:|.. .||.||:|.:....|||||:|:|.|.|.|.|||..||
  Fly   208 RRHYGRPYFLPEGSENNAVDWFFIGLSGLGAQMHIDNVRLPSWQAQLAGSKRWLLVPPPECYLQC 272

  Fly   291 QPFSFYVEPGDAVLVDTRIWYHANSIPKGQFSLTVQSEY 329
            :.|...|:.||.:::||..|||...:..|..|||:.:||
  Fly   273 RRFDVVVQQGDIIVLDTNKWYHQTFVQPGAISLTIGAEY 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2211NP_001261251.1 cupin_like 133..>306 CDD:304367 60/176 (34%)
CG14331NP_001097824.1 cupin_like 110..>265 CDD:304367 50/154 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I4498
eggNOG 1 0.900 - - E1_28JVU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D102909at33392
OrthoFinder 1 1.000 - - FOG0009994
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12480
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.