DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2211 and JMJD4

DIOPT Version :9

Sequence 1:NP_001261251.1 Gene:CG2211 / 38157 FlyBaseID:FBgn0035211 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001286031.1 Gene:JMJD4 / 35089 FlyBaseID:FBgn0032671 Length:425 Species:Drosophila melanogaster


Alignment Length:269 Identity:48/269 - (17%)
Similarity:88/269 - (32%) Gaps:83/269 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 DCEFCKGV------------RAPLILANL---------TMEEFAPHAYSSMPIIVKRAVAHWPAQ 157
            :.|.|.|:            ..|:|:||:         |:.:.:|.:         |.:...|:.
  Fly    29 EIERCSGLDYNDFFWRYMHKNIPVIIANVSNDWECQNWTVGQSSPES---------RDLNSNPSA 84

  Fly   158 KNLSFAFIKELYESVPGAMDSDCQFLHFNSDLK-SLKHVFSMSAERSNL-TQGVPWFVGWSVCQP 220
            .:::|.::|......|..: ::|...:|||..| .|.....::..||:: :|....:....|...
  Fly    85 SSINFDYLKTKISDGPVPV-ANCNSSYFNSHTKLELNFHDYLAKWRSSIESQSSAAWTSAEVNSN 148

  Fly   221 AVLAELRKLYPRPHFLPFDAEMPHTD--------------------------FILMGYEQG-AVM 258
            ...|....||.:...|.  |:||..:                          |:.||.:.. ...
  Fly   149 VAPASGDNLYLKDWHLA--AQMPGYNFYKVPKYFASDWLNEQLIQQGKDDYRFVYMGPKNSWTSY 211

  Fly   259 HLDYIPRLLWQAQLSGNKTWFLAPAPE--------------------CDHQCQPFSFYVEPGDAV 303
            |.|......|...:.|.|.|.:.|..|                    .:|..:.::......:||
  Fly   212 HADVFGSFSWSTNIVGLKKWLIMPPGEELKLNDRLGNLPFSIDEKMLDEHNVRYYTINQRANEAV 276

  Fly   304 LVDTRIWYH 312
            .|.:. |:|
  Fly   277 FVPSG-WFH 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2211NP_001261251.1 cupin_like 133..>306 CDD:304367 37/221 (17%)
JMJD4NP_001286031.1 JmjC 172..221 CDD:214721 5/48 (10%)
JmjC 199..299 CDD:202224 17/87 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12480
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.