DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2211 and JMJD6

DIOPT Version :9

Sequence 1:NP_001261251.1 Gene:CG2211 / 38157 FlyBaseID:FBgn0035211 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001074930.1 Gene:JMJD6 / 23210 HGNCID:19355 Length:414 Species:Homo sapiens


Alignment Length:241 Identity:50/241 - (20%)
Similarity:80/241 - (33%) Gaps:79/241 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 LTMEEFA-----PHAYSSMPIIVKRAVAHWPAQKNLSFAFIKELYE-------------SVPGAM 176
            |::|||.     |:    .|:::..|...|.||:..:...:|..|.             ||...|
Human    54 LSVEEFVERYERPY----KPVVLLNAQEGWSAQEKWTLERLKRKYRNQKFKCGEDNDGYSVKMKM 114

  Fly   177 DSDCQFLHFNSDLKSLKHVFSMS----AERSNLTQG--VPWFVGWSVCQPAVLAELRKLYPRPHF 235
            ....:::....|...| ::|..|    .:|..|.:.  ||.|....:.|.|  .|.|    ||  
Human   115 KYYIEYMESTRDDSPL-YIFDSSYGEHPKRRKLLEDYKVPKFFTDDLFQYA--GEKR----RP-- 170

  Fly   236 LPFDAEMPHTDFILMGYEQGAVMHLDYIPRLLWQAQLSGNKTWFLAPA----------------- 283
                   |:..|::.....|..:|:|.:....|.|.:.|:|.|.|.|.                 
Human   171 -------PYRWFVMGPPRSGTGIHIDPLGTSAWNALVQGHKRWCLFPTSTPRELIKVTRDEGGNQ 228

  Fly   284 -----------------PECDHQCQPFSFYVEPGDAVLVDTRIWYH 312
                             |....:.:|.....:||:.|.|... |:|
Human   229 QDEAITWFNVIYPRTQLPTWPPEFKPLEILQKPGETVFVPGG-WWH 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2211NP_001261251.1 cupin_like 133..>306 CDD:304367 46/230 (20%)
JMJD6NP_001074930.1 Nuclear localization signal 1. /evidence=ECO:0000269|PubMed:14729065 6..10
Nuclear localization signal 2. /evidence=ECO:0000269|PubMed:14729065 91..95 1/3 (33%)
Nuclear localization signal 3. /evidence=ECO:0000269|PubMed:14729065 141..145 1/3 (33%)
Nuclear localization signal 4. /evidence=ECO:0000269|PubMed:14729065 167..170 1/6 (17%)
JmjC 174..288 CDD:334913 19/101 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 336..403
Nuclear localization signal 5. /evidence=ECO:0000269|PubMed:14729065 373..378
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.