DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-ACP and ACP1

DIOPT Version :9

Sequence 1:NP_001261250.1 Gene:ND-ACP / 38154 FlyBaseID:FBgn0011361 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_012729.1 Gene:ACP1 / 853642 SGDID:S000001675 Length:125 Species:Saccharomyces cerevisiae


Alignment Length:112 Identity:44/112 - (39%)
Similarity:68/112 - (60%) Gaps:11/112 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 SAYDKECRGR---WQTQLVRR-YSAKPPLSLKLINERVLLVLKLYDKIDPS----KLNVESHFIN 131
            ||| :...||   ..|.|.:| |||.  ||...:::||:.|:|.:||..|:    :::.::.|..
Yeast    15 SAY-RTIMGRSVMSNTILAQRFYSAN--LSKDQVSQRVIDVIKAFDKNSPNIANKQISSDTQFHK 76

  Fly   132 DLGLDSLDHVEVIMAMEDEFGFEIPDSDAEKLLKPADIIKYVADKED 178
            ||||||||.||:::|:|:||..||||..|::|....:.:.|:|...|
Yeast    77 DLGLDSLDTVELLVAIEEEFDIEIPDKVADELRSVGETVDYIASNPD 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-ACPNP_001261250.1 acpP <118..176 CDD:179197 24/61 (39%)
ACP1NP_012729.1 acyl_carrier 46..122 CDD:213536 30/75 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343043
Domainoid 1 1.000 51 1.000 Domainoid score I2878
eggNOG 1 0.900 - - E1_COG0236
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I1720
Isobase 1 0.950 - 0 Normalized mean entropy S953
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001859
OrthoInspector 1 1.000 - - oto99423
orthoMCL 1 0.900 - - OOG6_100820
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R18
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.630

Return to query results.
Submit another query.