DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-ACP and mtACP2

DIOPT Version :10

Sequence 1:NP_001261250.1 Gene:ND-ACP / 38154 FlyBaseID:FBgn0011361 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_176708.1 Gene:mtACP2 / 842836 AraportID:AT1G65290 Length:126 Species:Arabidopsis thaliana


Alignment Length:78 Identity:41/78 - (52%)
Similarity:60/78 - (76%) Gaps:3/78 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 LVRRYSAKPP---LSLKLINERVLLVLKLYDKIDPSKLNVESHFINDLGLDSLDHVEVIMAMEDE 150
            |:||:|.:..   |....:.:|||.|:|.:.|:||||:..:::|.|||||||||.|||:||:|:|
plant    32 LLRRFSEEVRGSFLDKSEVTDRVLSVVKNFQKVDPSKVTPKANFQNDLGLDSLDSVEVVMALEEE 96

  Fly   151 FGFEIPDSDAEKL 163
            |||||||::|:|:
plant    97 FGFEIPDNEADKI 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-ACPNP_001261250.1 acpP <118..176 CDD:179197 30/46 (65%)
mtACP2NP_176708.1 PP-binding <41..126 CDD:447865 37/69 (54%)

Return to query results.
Submit another query.