DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-ACP and mtACP2

DIOPT Version :9

Sequence 1:NP_001261250.1 Gene:ND-ACP / 38154 FlyBaseID:FBgn0011361 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_176708.1 Gene:mtACP2 / 842836 AraportID:AT1G65290 Length:126 Species:Arabidopsis thaliana


Alignment Length:78 Identity:41/78 - (52%)
Similarity:60/78 - (76%) Gaps:3/78 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 LVRRYSAKPP---LSLKLINERVLLVLKLYDKIDPSKLNVESHFINDLGLDSLDHVEVIMAMEDE 150
            |:||:|.:..   |....:.:|||.|:|.:.|:||||:..:::|.|||||||||.|||:||:|:|
plant    32 LLRRFSEEVRGSFLDKSEVTDRVLSVVKNFQKVDPSKVTPKANFQNDLGLDSLDSVEVVMALEEE 96

  Fly   151 FGFEIPDSDAEKL 163
            |||||||::|:|:
plant    97 FGFEIPDNEADKI 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-ACPNP_001261250.1 acpP <118..176 CDD:179197 30/46 (65%)
mtACP2NP_176708.1 PP-binding <41..126 CDD:385641 37/69 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 72 1.000 Domainoid score I3314
eggNOG 1 0.900 - - E1_COG0236
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I2345
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1473625at2759
OrthoFinder 1 1.000 - - FOG0001859
OrthoInspector 1 1.000 - - otm2931
orthoMCL 1 0.900 - - OOG6_100820
Panther 1 1.100 - - O PTHR20863
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2432
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.920

Return to query results.
Submit another query.