DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-ACP and ACP2

DIOPT Version :9

Sequence 1:NP_001261250.1 Gene:ND-ACP / 38154 FlyBaseID:FBgn0011361 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_175860.1 Gene:ACP2 / 841900 AraportID:AT1G54580 Length:136 Species:Arabidopsis thaliana


Alignment Length:77 Identity:23/77 - (29%)
Similarity:42/77 - (54%) Gaps:5/77 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 TQLVRRYSAKPPLSLKLINERVLLVLKLYDKIDPSKLNVESHFINDLGLDSLDHVEVIMAMEDEF 151
            |:|....:|||    :.:::...:|.|.....:..::...:.|. .||.||||.||::|.:|:||
plant    46 TRLTVSCAAKP----ETVDKVCAVVRKQLSLKEADEITAATKFA-ALGADSLDTVEIVMGLEEEF 105

  Fly   152 GFEIPDSDAEKL 163
            |.|:.:..|:.:
plant   106 GIEMAEEKAQSI 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-ACPNP_001261250.1 acpP <118..176 CDD:179197 16/46 (35%)
ACP2NP_175860.1 PP-binding 57..130 CDD:415812 18/62 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0236
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1473625at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.