powered by:
Protein Alignment ND-ACP and mtACP3
DIOPT Version :9
Sequence 1: | NP_001261250.1 |
Gene: | ND-ACP / 38154 |
FlyBaseID: | FBgn0011361 |
Length: | 181 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001078726.1 |
Gene: | mtACP3 / 834813 |
AraportID: | AT5G47630 |
Length: | 131 |
Species: | Arabidopsis thaliana |
Alignment Length: | 70 |
Identity: | 31/70 - (44%) |
Similarity: | 45/70 - (64%) |
Gaps: | 0/70 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 104 INERVLLVLKLYDKIDPSKLNVESHFINDLGLDSLDHVEVIMAMEDEFGFEIPDSDAEKLLKPAD 168
|..||:.::|.|||.:.|::...:.|..||.|||||..|::||:|:||..||||..|:||....|
plant 51 ILSRVIELVKKYDKTNTSEVTERADFQKDLSLDSLDKTELVMAIEEEFSIEIPDEKADKLTCCGD 115
Fly 169 IIKYV 173
:..|:
plant 116 VATYI 120
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0236 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1473625at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001859 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_100820 |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR20863 |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
7 | 6.780 |
|
Return to query results.
Submit another query.