DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-ACP and mtACP3

DIOPT Version :9

Sequence 1:NP_001261250.1 Gene:ND-ACP / 38154 FlyBaseID:FBgn0011361 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001078726.1 Gene:mtACP3 / 834813 AraportID:AT5G47630 Length:131 Species:Arabidopsis thaliana


Alignment Length:70 Identity:31/70 - (44%)
Similarity:45/70 - (64%) Gaps:0/70 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 INERVLLVLKLYDKIDPSKLNVESHFINDLGLDSLDHVEVIMAMEDEFGFEIPDSDAEKLLKPAD 168
            |..||:.::|.|||.:.|::...:.|..||.|||||..|::||:|:||..||||..|:||....|
plant    51 ILSRVIELVKKYDKTNTSEVTERADFQKDLSLDSLDKTELVMAIEEEFSIEIPDEKADKLTCCGD 115

  Fly   169 IIKYV 173
            :..|:
plant   116 VATYI 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-ACPNP_001261250.1 acpP <118..176 CDD:179197 24/56 (43%)
mtACP3NP_001078726.1 PP-binding <49..120 CDD:299128 30/68 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0236
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1473625at2759
OrthoFinder 1 1.000 - - FOG0001859
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100820
Panther 1 1.100 - - O PTHR20863
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.780

Return to query results.
Submit another query.