powered by:
Protein Alignment ND-ACP and AT5G36280
DIOPT Version :9
Sequence 1: | NP_001261250.1 |
Gene: | ND-ACP / 38154 |
FlyBaseID: | FBgn0011361 |
Length: | 181 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_198477.1 |
Gene: | AT5G36280 / 833626 |
AraportID: | AT5G36280 |
Length: | 75 |
Species: | Arabidopsis thaliana |
Alignment Length: | 42 |
Identity: | 13/42 - (30%) |
Similarity: | 24/42 - (57%) |
Gaps: | 2/42 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 89 LVRRYS--AKPPLSLKLINERVLLVLKLYDKIDPSKLNVESH 128
|:||:| .:..|....:..|.|.::|.:.|.:|||:..:|:
plant 33 LLRRFSKEVRAFLYTSEVTYRFLSIVKNFQKFEPSKVFSDSY 74
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
ND-ACP | NP_001261250.1 |
acpP |
<118..176 |
CDD:179197 |
4/11 (36%) |
AT5G36280 | NP_198477.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0236 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1473625at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001859 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.910 |
|
Return to query results.
Submit another query.