DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-ACP and AT5G36280

DIOPT Version :9

Sequence 1:NP_001261250.1 Gene:ND-ACP / 38154 FlyBaseID:FBgn0011361 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_198477.1 Gene:AT5G36280 / 833626 AraportID:AT5G36280 Length:75 Species:Arabidopsis thaliana


Alignment Length:42 Identity:13/42 - (30%)
Similarity:24/42 - (57%) Gaps:2/42 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 LVRRYS--AKPPLSLKLINERVLLVLKLYDKIDPSKLNVESH 128
            |:||:|  .:..|....:..|.|.::|.:.|.:|||:..:|:
plant    33 LLRRFSKEVRAFLYTSEVTYRFLSIVKNFQKFEPSKVFSDSY 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-ACPNP_001261250.1 acpP <118..176 CDD:179197 4/11 (36%)
AT5G36280NP_198477.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0236
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1473625at2759
OrthoFinder 1 1.000 - - FOG0001859
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.