DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-ACP and MTACP-1

DIOPT Version :9

Sequence 1:NP_001261250.1 Gene:ND-ACP / 38154 FlyBaseID:FBgn0011361 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_181990.1 Gene:MTACP-1 / 819070 AraportID:AT2G44620 Length:122 Species:Arabidopsis thaliana


Alignment Length:144 Identity:51/144 - (35%)
Similarity:75/144 - (52%) Gaps:40/144 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 MMHRIAVPSMTSQLSQ-KFG----VRSYSAKSTIEDIKFRVLKVVSAYDKECRGRWQTQLVRRYS 94
            ::..:.||..|..|:| |.|    :||:                 |::|..              
plant     7 ILRHLRVPVQTLGLNQSKIGFLGTIRSF-----------------SSHDDH-------------- 40

  Fly    95 AKPPLSLKLINERVLLVLKLYDKIDPSKLNVESHFINDLGLDSLDHVEVIMAMEDEFGFEIPDSD 159
                ||.:.:.:|||.|:|.:.|:||||:..|.||.|||||||||.||::||:|:||..||||.:
plant    41 ----LSREAVVDRVLDVVKSFPKVDPSKVTPEVHFQNDLGLDSLDTVEIVMAIEEEFKLEIPDKE 101

  Fly   160 AEKLLKPADIIKYV 173
            |:|:...:..|:||
plant   102 ADKIDSCSLAIEYV 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-ACPNP_001261250.1 acpP <118..176 CDD:179197 32/56 (57%)
MTACP-1NP_181990.1 PP-binding <32..121 CDD:415812 44/119 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 72 1.000 Domainoid score I3314
eggNOG 1 0.900 - - E1_COG0236
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I2345
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1473625at2759
OrthoFinder 1 1.000 - - FOG0001859
OrthoInspector 1 1.000 - - otm2931
orthoMCL 1 0.900 - - OOG6_100820
Panther 1 1.100 - - O PTHR20863
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2432
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.