DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-ACP and ndufab1a

DIOPT Version :9

Sequence 1:NP_001261250.1 Gene:ND-ACP / 38154 FlyBaseID:FBgn0011361 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001003418.1 Gene:ndufab1a / 573619 ZFINID:ZDB-GENE-040801-1 Length:155 Species:Danio rerio


Alignment Length:122 Identity:64/122 - (52%)
Similarity:87/122 - (71%) Gaps:14/122 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 KSTIEDIKFRVLKVVSAYDKECRGRWQTQLVRRYSAKPPLSLKLINERVLLVLKLYDKIDPSKLN 124
            ||::..:....|::.         :|     |::...|||:||.::||||.||||||||:|.||.
Zfish    48 KSSLAQVSGSSLQIF---------QW-----RQFCDSPPLTLKTVHERVLYVLKLYDKINPEKLQ 98

  Fly   125 VESHFINDLGLDSLDHVEVIMAMEDEFGFEIPDSDAEKLLKPADIIKYVADKEDVYE 181
            |.|||:.||||||||.||:||||||||||||||.|||||:.|..:::|:|:|::|:|
Zfish    99 VTSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDEDAEKLMTPEQVVQYIAEKKEVHE 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-ACPNP_001261250.1 acpP <118..176 CDD:179197 40/57 (70%)
ndufab1aNP_001003418.1 acpP <92..152 CDD:179197 41/59 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577692
Domainoid 1 1.000 90 1.000 Domainoid score I7759
eggNOG 1 0.900 - - E1_COG0236
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 135 1.000 Inparanoid score I4558
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1473625at2759
OrthoFinder 1 1.000 - - FOG0001859
OrthoInspector 1 1.000 - - otm24463
orthoMCL 1 0.900 - - OOG6_100820
Panther 1 1.100 - - O PTHR20863
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R18
SonicParanoid 1 1.000 - - X2432
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.