DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-ACP and NDUFAB1

DIOPT Version :9

Sequence 1:NP_001261250.1 Gene:ND-ACP / 38154 FlyBaseID:FBgn0011361 Length:181 Species:Drosophila melanogaster
Sequence 2:XP_011544158.2 Gene:NDUFAB1 / 4706 HGNCID:7694 Length:187 Species:Homo sapiens


Alignment Length:95 Identity:69/95 - (72%)
Similarity:81/95 - (85%) Gaps:0/95 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 TQLVRRYSAKPPLSLKLINERVLLVLKLYDKIDPSKLNVESHFINDLGLDSLDHVEVIMAMEDEF 151
            |||.|:||..|||:|:.|.:|||.||||||||||.||:|.|||:.||||||||.||:||||||||
Human    93 TQLCRQYSDMPPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEF 157

  Fly   152 GFEIPDSDAEKLLKPADIIKYVADKEDVYE 181
            ||||||.|||||:.|.:|:.|:|||:||||
Human   158 GFEIPDIDAEKLMCPQEIVDYIADKKDVYE 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-ACPNP_001261250.1 acpP <118..176 CDD:179197 42/57 (74%)
NDUFAB1XP_011544158.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144558
Domainoid 1 1.000 92 1.000 Domainoid score I7641
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4465
Isobase 1 0.950 - 0 Normalized mean entropy S953
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1473625at2759
OrthoFinder 1 1.000 - - FOG0001859
OrthoInspector 1 1.000 - - oto89490
orthoMCL 1 0.900 - - OOG6_100820
Panther 1 1.100 - - LDO PTHR20863
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2432
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.810

Return to query results.
Submit another query.