DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-ACP and SPAC4H3.09

DIOPT Version :9

Sequence 1:NP_001261250.1 Gene:ND-ACP / 38154 FlyBaseID:FBgn0011361 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_594345.1 Gene:SPAC4H3.09 / 2543562 PomBaseID:SPAC4H3.09 Length:112 Species:Schizosaccharomyces pombe


Alignment Length:87 Identity:42/87 - (48%)
Similarity:56/87 - (64%) Gaps:5/87 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 QLVRRYSAKPPLSLKLINERVLLVLKLYDKI-DPSKLNVESHFINDLGLDSLDHVEVIMAMEDEF 151
            |.:|.||...|.:.|    |:|.|:..:||| ||.|:...|.|.|||||||||.|||:||:|:||
pombe    23 QPLRFYSVARPDAEK----RILKVVSSFDKIQDPKKVTPTSTFANDLGLDSLDAVEVVMAIEEEF 83

  Fly   152 GFEIPDSDAEKLLKPADIIKYV 173
            ..:|||.||:::....|.|.|:
pombe    84 SIQIPDKDADEITSVGDAISYI 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-ACPNP_001261250.1 acpP <118..176 CDD:179197 31/57 (54%)
SPAC4H3.09NP_594345.1 PP-binding <26..112 CDD:299128 41/84 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 67 1.000 Domainoid score I2761
eggNOG 1 0.900 - - E1_COG0236
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I1884
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001859
OrthoInspector 1 1.000 - - oto101016
orthoMCL 1 0.900 - - OOG6_100820
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R18
SonicParanoid 1 1.000 - - X2432
TreeFam 1 0.960 - -
1110.750

Return to query results.
Submit another query.