DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myo61F and Myo15b

DIOPT Version :10

Sequence 1:NP_476934.2 Gene:Myo61F / 38153 FlyBaseID:FBgn0010246 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_001371162.1 Gene:Myo15b / 217328 MGIID:2685534 Length:3069 Species:Mus musculus


Alignment Length:32 Identity:8/32 - (25%)
Similarity:17/32 - (53%) Gaps:6/32 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 NMLLAERISKRYQKPSRGDIVVIRSPENPNKT 88
            |.|...::|::.::|.: ::|.     .|.||
Mouse    79 NRLRERKVSEKSKEPEK-EVVA-----EPTKT 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myo61FNP_476934.2 MYSc_Myo1 52..707 CDD:276829 8/32 (25%)
Myosin_TH1 863..1049 CDD:461801
Myo15bNP_001371162.1 PTZ00449 <185..>326 CDD:185628
MYSc_Myo35 681..1360 CDD:276861
MyTH4 1575..1677 CDD:459939
SH3 2469..2523 CDD:473055
MyTH4 2617..2763 CDD:470587
FERM_M 2853..2968 CDD:459788
PH-like 2964..3064 CDD:473070
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.