DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Herc4 and AREL1

DIOPT Version :9

Sequence 1:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster
Sequence 2:NP_001034568.1 Gene:AREL1 / 9870 HGNCID:20363 Length:823 Species:Homo sapiens


Alignment Length:637 Identity:141/637 - (22%)
Similarity:246/637 - (38%) Gaps:142/637 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   516 ESMRLYLLLPL-----YHEFVNSKHYKSLQVPFANA---IFKLAENPRKVLNKWLAQTPAE-YFE 571
            ::.:::|.|.|     :|..::.::.     |..|.   |..|:|:.:.::.:.::.:... |||
Human   239 QTFQVFLRLTLHSRGCFHACISYQNQ-----PINNGEFDIIVLSEDEKNIVERNVSTSGVSIYFE 298

  Fly   572 HLVQNFLH---VVIHIISFKMGLAAASPS--AERRQQLLPYNTEL-EIILKLMKTLCQINNERHD 630
            ..:.|..:   ...|:....|..:...||  .:...:..|..... |.:.|..|..|.::.::. 
Human   299 AYLYNATNCSSTPWHLPPMHMTSSQRRPSTAVDEEDEDSPSECHTPEKVKKPKKVYCYVSPKQF- 362

  Fly   631 RLNYQIFYWPDLSDYADVQQEYVKWIMADTARDFNIC---NYSFIF-DQSAKTALLQADQALQ-- 689
                            .|::.|:| |:......|.:|   .:|::. |...|...|..|..:|  
Human   363 ----------------SVKEFYLK-IIPWRLYTFRVCPGTKFSYLGPDPVHKLLTLVVDDGIQPP 410

  Fly   690 ------------------MHSAMANAATM--AFSFFNYGM-------PISQFIVLNVTRENLVQD 727
                              :|..:..:.|.  ..:||...:       |.|: :.|.|:|..|::.
Human   411 VELSCKERNILAATFIRSLHKNIGGSETFQDKVNFFQRELRQVHMKRPHSK-VTLKVSRHALLES 474

  Fly   728 SLRELQHYSQSDLKKPLKIKFHGEEAEDAGGVRKEFFMLLLKDLLDPKYGMFKEYEQSRLLWFAD 792
            ||:..:::|.||..|..::.|..|||.|.||.|:|:|.|:.|.|.|....:|..:..:.    ..
Human   475 SLKATRNFSISDWSKNFEVVFQDEEALDWGGPRREWFELICKALFDTTNQLFTRFSDNN----QA 535

  Fly   793 LTFETEN--------MYFLIGVLCGLAIYNFT-------IINLPFPLALFKKLLGKPVDLSDLR- 841
            |.....|        ||...|.|.|..:|..:       ::...|..:...:::|       || 
Human   536 LVHPNPNRPAHLRLKMYEFAGRLVGKCLYESSLGGAYKQLVRARFTRSFLAQIIG-------LRM 593

  Fly   842 -----QLSPPEANSMQSLLDYQGDDFKEVFDLTFEISRDVFGEAETKC-----------LKPNGN 890
                 :...||.        |:.   |..|.|..::|......||.|.           |...|.
Human   594 HYKYFETDDPEF--------YKS---KVCFILNNDMSEMELVFAEEKYNKSGQLDKVVELMTGGA 647

  Fly   891 EIAVTLENRQEFVDLYVDFVFNKSVELHYNAFHKGFMKVCSGRVIHIFQPEELMAVVVGNEDY-- 953
            :..||..|:..:::|...:.....|:.....|.||..::....::.||...||..::.|..|.  
Human   648 QTPVTNANKIFYLNLLAQYRLASQVKEEVEHFLKGLNELVPENLLAIFDENELELLMCGTGDISV 712

  Fly   954 -DWQA----LQDNCEYREGYTSVDDTIKWFWEVIHDMSEAEKKSFLLFLTGSDRIPIQGMKAL-- 1011
             |::|    :..:..:||      ..::|||.|:..:::.|....|.|.|||.::|..|..||  
Human   713 SDFKAHAVVVGGSWHFRE------KVMRWFWTVVSSLTQEELARLLQFTTGSSQLPPGGFAALCP 771

  Fly  1012 KLTIQPTPDERFLPVAHTCFNLLDLPRYKTKERLKYKLLQAIQQ-TQGFSLV 1062
            ...|...|....||.||||||.|.||.|.:.|.:...|..||.: .:||.::
Human   772 SFQIIAAPTHSTLPTAHTCFNQLCLPTYDSYEEVHRMLQLAISEGCEGFGML 823

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Herc4NP_001261249.1 RCC1 6..55 CDD:278826
RCC1 59..110 CDD:278826
RCC1 114..163 CDD:278826
RCC1 167..218 CDD:278826
RCC1 221..270 CDD:278826
RCC1 273..322 CDD:278826
RCC1_2 309..339 CDD:290274
RCC1 327..390 CDD:278826
HECTc 715..1060 CDD:238033 100/386 (26%)
HECTc 739..1059 CDD:214523 91/361 (25%)
AREL1NP_001034568.1 Filamin 52..158
Filamin 56..154 CDD:395505
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 315..345 4/29 (14%)
Interaction with SOCS2. /evidence=ECO:0000269|PubMed:31578312 483..789 80/333 (24%)
HECTc 486..820 CDD:214523 91/361 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.