DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Herc4 and TRIP12

DIOPT Version :9

Sequence 1:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster
Sequence 2:XP_024308991.1 Gene:TRIP12 / 9320 HGNCID:12306 Length:2092 Species:Homo sapiens


Alignment Length:402 Identity:107/402 - (26%)
Similarity:177/402 - (44%) Gaps:71/402 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   719 VTRENLVQDSLRELQHYSQSDLKKPLKIKFHGEEAEDAGGVRKEFFMLLLKDLLDPKYGMFK--- 780
            |.||.|::.:...:|....|  :..|:|::..|.....|.. .||:.|:.::|.....|:::   
Human  1693 VNREELLKQAESVMQDLGSS--RAMLEIQYENEVGTGLGPT-LEFYALVSQELQRADLGLWRGEE 1754

  Fly   781 -------------EYEQSRLLWFADLTF----------ETENMYFLIGVLCGLAIYNFTIINLPF 822
                         :|.|:....|| |.|          :.:..:..:|.|...||.:|.:::||.
Human  1755 VTLSNPKGSQEGTKYIQNLQGLFA-LPFGRTAKPAHIAKVKMKFRFLGKLMAKAIMDFRLVDLPL 1818

  Fly   823 PLALFKKLLGKPVDLS--DLRQLSPPEANSMQSL---------LDYQGDDFKE------------ 864
            .|..:|.:|.:...|:  ||..:.|..|.|:..|         |:......||            
Human  1819 GLPFYKWMLRQETSLTSHDLFDIDPVVARSVYHLEDIVRQKKRLEQDKSQTKESLQYALETLTMN 1883

  Fly   865 ---VFDLTFEISRDVFGEAETKCLKPNGNEIAVTLENRQEFVDLYVDFVFNKSVELHYNAFHKGF 926
               |.||..:.:...|...|   ||..|.:|.||:.|.:|::.|.:.:..|:.|...:::|..||
Human  1884 GCSVEDLGLDFTLPGFPNIE---LKKGGKDIPVTIHNLEEYLRLVIFWALNEGVSRQFDSFRDGF 1945

  Fly   927 MKVCSGRVIHIFQPEELMAVVVGNEDYDWQA--LQDNCEYREGYTSVDDTIKWFWEVIHDMSEAE 989
            ..|.....:..|.||||..::.|::...|.|  |.:.|....|||.....:|:.:|::......:
Human  1946 ESVFPLSHLQYFYPEELDQLLCGSKADTWDAKTLMECCRPDHGYTHDSRAVKFLFEILSSFDNEQ 2010

  Fly   990 KKSFLLFLTGSDRIPIQGMKALK--LTI-------QPTPDERFLPVAHTCFNLLDLPRYKTKERL 1045
            ::.||.|:|||.|:|:.|.::|.  |||       ...||: |||...||.|.|.||.|.:.|.:
Human  2011 QRLFLQFVTGSPRLPVGGFRSLNPPLTIVRKTFESTENPDD-FLPSVMTCVNYLKLPDYSSIEIM 2074

  Fly  1046 KYKLLQAIQQTQ 1057
            :.|||.|.::.|
Human  2075 REKLLIAAREGQ 2086

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Herc4NP_001261249.1 RCC1 6..55 CDD:278826
RCC1 59..110 CDD:278826
RCC1 114..163 CDD:278826
RCC1 167..218 CDD:278826
RCC1 221..270 CDD:278826
RCC1 273..322 CDD:278826
RCC1_2 309..339 CDD:290274
RCC1 327..390 CDD:278826
HECTc 715..1060 CDD:238033 107/402 (27%)
HECTc 739..1059 CDD:214523 101/382 (26%)
TRIP12XP_024308991.1 SR-25 99..>233 CDD:313680
Arm_3 489..>714 CDD:330530
WWE 808..874 CDD:308464
HECTc 1690..2090 CDD:238033 107/402 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.