DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Herc4 and RCCD1

DIOPT Version :9

Sequence 1:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster
Sequence 2:NP_001017919.1 Gene:RCCD1 / 91433 HGNCID:30457 Length:376 Species:Homo sapiens


Alignment Length:383 Identity:103/383 - (26%)
Similarity:150/383 - (39%) Gaps:64/383 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 WGSTSHGQLGLGGIEDEQILTPSQIPWTPDTAVQQVACGHRHTLFLTATGKVYACGSNDYSQLGH 74
            :|....|| .||.....|:.:||  |......:.:|:....:|.|:|..|::...||..    |.
Human    12 FGFCGFGQ-ELGSGRGRQVHSPS--PLRAGVDICRVSASWSYTAFVTRGGRLELSGSAS----GA 69

  Fly    75 DLPTKRPRMSPFLLI-------PELQDYVIIQICCGSRHSLALSDWGQ-VLSWGDNDCGQLGHAT 131
            ....|....|..||.       ||    .::|:............|.| |:...:.:....|.|.
Human    70 AGRCKDAWASEGLLAVLRAGPGPE----ALLQVWAAESALRGEPLWAQNVVPEAEGEDDPAGEAQ 130

  Fly   132 DKEIVQLPKVVRQLVTKTVV------------QIACGNNHSLALTSCGELYSWGSNIYGQLGVNS 184
            ...:..|| ..|..|:....            |:..|..|:|.|.:.|:::|||...:||||..:
Human   131 AGRLPLLP-CARAYVSPRAPFYRPLAPELRARQLELGAEHALLLDAAGQVFSWGGGRHGQLGHGT 194

  Fly   185 PNDLTHCNYPLRLTTLLGIPLAAIACGGNHSFLISKSGAVFGWGRNNCGQLGLNDETNRSYPTQL 249
               |.....|..|..|.|:.:|.:|.||.||..:|::|.::.||.|..|||.|        ||  
Human   195 ---LEAELEPRLLEALQGLVMAEVAAGGWHSVCVSETGDIYIWGWNESGQLAL--------PT-- 246

  Fly   250 KTLRTLGVRFVACGDEFSVFLTNEGGVFTCGAGAYGQLGHGFSSNEMLPRMVMELMGSTITQVAC 314
            :.|...|........|    |..:|.......||.......|.:.:..|.::...|||...:.:|
Human   247 RNLAEDGETVAREATE----LNEDGSQVKRTGGAEDGAPAPFIAVQPFPALLDLPMGSDAVKASC 307

  Fly   315 GNRHTLALVPSRGRVYAFGLGSSGQLGTRSTKSLMLPQ--------------VVIGPW 358
            |:||| |:|...|.:|.:|.|..||||...|.||..|:              |..|||
Human   308 GSRHT-AVVTRTGELYTWGWGKYGQLGHEDTTSLDRPRRVEYFVDKQLQVKAVTCGPW 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Herc4NP_001261249.1 RCC1 6..55 CDD:278826 11/44 (25%)
RCC1 59..110 CDD:278826 11/57 (19%)
RCC1 114..163 CDD:278826 12/61 (20%)
RCC1 167..218 CDD:278826 19/50 (38%)
RCC1 221..270 CDD:278826 13/48 (27%)
RCC1 273..322 CDD:278826 13/48 (27%)
RCC1_2 309..339 CDD:290274 11/29 (38%)
RCC1 327..390 CDD:278826 16/46 (35%)
HECTc 715..1060 CDD:238033
HECTc 739..1059 CDD:214523
RCCD1NP_001017919.1 Interaction with KDM8. /evidence=ECO:0000269|PubMed:24981860 1..169 35/168 (21%)
ATS1 <156..340 CDD:227511 63/201 (31%)
RCC1 2 176..227 19/53 (36%)
RCC1 3 229..317 29/102 (28%)
RCC1 4 318..371 16/47 (34%)
RCC1 319..366 CDD:395335 16/46 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.