DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Herc4 and FMP25

DIOPT Version :9

Sequence 1:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster
Sequence 2:NP_013178.1 Gene:FMP25 / 850766 SGDID:S000004067 Length:583 Species:Saccharomyces cerevisiae


Alignment Length:324 Identity:73/324 - (22%)
Similarity:122/324 - (37%) Gaps:86/324 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 VQQVACGHRHTLFLTATGKVYACGS-NDYSQL-----GHDLPTKRPRMSPFLLIPELQDYVIIQI 100
            |.|...|..|.:.|:..||.|.|.: ||..|.     ...:||    .|.|...|.......|::
Yeast   297 VVQFDAGSHHLVLLSNLGKAYCCATGNDQKQAQVSKGQFGIPT----FSQFDEFPPNNQLFEIEL 357

  Fly   101 CCGSRHSLALSDWGQVLSWGDNDCGQLGHATDKEIVQLPKVVRQLVTKTVVQIACGNNHSLALTS 165
            ....:|.            |::                  |||:   :.:.:||||:.|:||:..
Yeast   358 LNKFKHE------------GED------------------VVRK---REIKKIACGSYHTLAIDK 389

  Fly   166 CGELYSWGSNIYGQLGVNSPNDLTHCNYPLRLTTLLGIPLAAIACGGNHSFLISKSGAVFGWGRN 230
            .||:|::|.|.:|||.:....:|.:.::|..:|               |:|.....| :..|   
Yeast   390 TGEIYAFGWNRFGQLALPISYNLEYVSFPRSVT---------------HAFKPHFPG-MTNW--- 435

  Fly   231 NCGQLGLNDETNRSYPTQLKTLRTLGVRFVACGDEFSVFLTNEGGVFTCGAGAYGQLGHGFSSNE 295
            .|..:..:|||:      ..|:|..|             .|::...|..|.|.:|:||:....|.
Yeast   436 KCVDIHCDDETS------FVTIRKPG-------------STSDHHYFAFGNGLFGELGNNTFKNS 481

  Fly   296 MLPRMVMELMGSTITQVACGNRHTLALVPSRGRVYAFGLGSSGQLG-----TRSTKSLMLPQVV 354
            ....:.::.....:|..:||:............|.|:|....||||     .:..|.:.:|:|:
Yeast   482 QCDPIKIKSDDKKLTNWSCGSHCVFTETEQENEVIAWGNNDHGQLGIGKKTMKCAKPMNIPEVL 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Herc4NP_001261249.1 RCC1 6..55 CDD:278826 4/12 (33%)
RCC1 59..110 CDD:278826 14/56 (25%)
RCC1 114..163 CDD:278826 10/48 (21%)
RCC1 167..218 CDD:278826 13/50 (26%)
RCC1 221..270 CDD:278826 9/48 (19%)
RCC1 273..322 CDD:278826 10/48 (21%)
RCC1_2 309..339 CDD:290274 6/29 (21%)
RCC1 327..390 CDD:278826 10/33 (30%)
HECTc 715..1060 CDD:238033
HECTc 739..1059 CDD:214523
FMP25NP_013178.1 ATS1 8..577 CDD:227511 73/324 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.