DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Herc4 and AT3G53830

DIOPT Version :9

Sequence 1:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster
Sequence 2:NP_001327553.1 Gene:AT3G53830 / 824550 AraportID:AT3G53830 Length:500 Species:Arabidopsis thaliana


Alignment Length:440 Identity:110/440 - (25%)
Similarity:160/440 - (36%) Gaps:139/440 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ELYCWGST-----------SHGQLGLGGIEDEQILTPSQIPWTPDTAVQQVACGHRHTLFLTATG 59
            :|..||||           .||:            ||...|...:..|.|.:.|..|...:|.||
plant    72 KLITWGSTDDEGQSYVASGKHGE------------TPEPFPLPTEAPVVQASSGWAHCAVVTETG 124

  Fly    60 KVYA-----C------------GSNDYSQLGHDL------------------------------- 76
            :.:.     |            ||::...:|.|:                               
plant   125 EAFTWGWKECIPSKDPVGKQQSGSSEQGDIGWDIFGCSVVIFLLLMDMVTFSIVIVSPASQGSNA 189

  Fly    77 ----------------PTKRPRMSP--------------FLLIPELQD----YVIIQICCGSRHS 107
                            ..||.|:|.              |...|.|..    ..|..:..|.||:
plant   190 ASGTTLQNENQKVGEESVKRRRVSTAKDETEGHTSGGDFFATTPSLVSVGLGVRITSVATGGRHT 254

  Fly   108 LALSDWGQVLSWGDNDCGQLGHATDKEIVQLPKVVRQL-----------------VTKTVVQ--- 152
            |||||.||:..||....||||..:..::|..|.::..|                 .|.|..|   
plant   255 LALSDLGQIWGWGYGGEGQLGLGSRIKMVSSPHLIPCLESIGSGKERSFILHQGGTTTTSAQASR 319

  Fly   153 --------IACGNNHSLALTSCGELYSWGSNIYGQLGVNSPNDLTHCNYPLRLTTLLGIPLAAIA 209
                    |:||..||.|:|..|.|.::|..:|||.|..:.||...   |:.::.:..:.:.::|
plant   320 EPGQYIKAISCGGRHSAAITDAGGLITFGWGLYGQCGHGNTNDQLR---PMAVSEVKSVRMESVA 381

  Fly   210 CGGNHSFLISKSGAVFGWGRNNCGQLGLNDETNRSYPTQL--KTLRTLGVRFVACGDEFSVFLTN 272
            .|..|:..||..|.|:.:|.|..||||...:.....|..|  :.|.....:.|:||...|..|..
plant   382 AGLWHTICISSDGKVYAFGGNQFGQLGTGTDHAEILPRLLDGQNLEGKHAKAVSCGARHSAVLAE 446

  Fly   273 EGGVFTCGAGAYGQLGHGFSSNEMLPRMVMELMGSTITQVACGNRHTLAL 322
            :|.:...|...|||||.|.:::..:|..| :|.|..:.:||||..|||.|
plant   447 DGQLLCWGWNKYGQLGLGDTNDRNIPTQV-QLDGCRLRKVACGWWHTLLL 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Herc4NP_001261249.1 RCC1 6..55 CDD:278826 14/59 (24%)
RCC1 59..110 CDD:278826 18/132 (14%)
RCC1 114..163 CDD:278826 19/76 (25%)
RCC1 167..218 CDD:278826 13/50 (26%)
RCC1 221..270 CDD:278826 15/50 (30%)
RCC1 273..322 CDD:278826 19/48 (40%)
RCC1_2 309..339 CDD:290274 8/14 (57%)
RCC1 327..390 CDD:278826
HECTc 715..1060 CDD:238033
HECTc 739..1059 CDD:214523
AT3G53830NP_001327553.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.