DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Herc4 and WWC2

DIOPT Version :9

Sequence 1:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster
Sequence 2:XP_011530571.1 Gene:WWC2 / 80014 HGNCID:24148 Length:1216 Species:Homo sapiens


Alignment Length:541 Identity:101/541 - (18%)
Similarity:180/541 - (33%) Gaps:164/541 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 RLTTLLGIPLAAIACGGNHSFLISKSGAVFGWGRNNCGQLGLNDETNRSYPTQLKTLRTLGVRFV 260
            :|||.|...|.:::.    |.|...||:..|...::.|.|      |.|....|.:|.:..:.:.
Human   418 KLTTYLHSQLK
SLSA----STLSMSSGSSLGSLASSRGSL------NTSSRGSLNSLSSTELYYS 472

  Fly   261 ACGDEFSV-------FLTNEGGVFTCGAGAYGQLGHG----FSSNEML--PRMVMELMGSTITQV 312
            :..|:..|       ||..|..         |.:..|    ...||::  |....:.....:...
Human   473 SQSDQIDVDYQYKLDFLLQEKS---------GYIPSGPITTIHENEVVKSPSQPGQSGLCGVAAA 528

  Fly   313 ACGNRHTLALVPSRGRVYAFGLGSSGQLGTRSTKSLMLPQ----VVIG--PWVSPSGSAL----- 366
            |.|:...||..|.          |...|.:||:.|.:.|.    |:.|  |..|...::|     
Human   529 ATGHTPPLAEAPK----------SVASLSSRSSLSSLSPPGSPLVLEGTFPMSSSHDASLHQFTA 583

  Fly   367 ------LQSNDSQVSLVIRQIFSGGDQSIVTTTLFVDKVPPE-----------DFRNYNPKSQIL 414
                  |.|:.:.:||:..||....|....:.:|..||...|           |.....||.:::
Human   584 DFEDCELSSHFADISLIENQILLDSDSGGASQSLSEDKDLNECAREPLYEGTADVEKSLPKRRVI 648

  Fly   415 TLTAEVTKQCAQCKQGLQSDMDLL--SSIELIFRSQACWNGSFLLDHDRHFGCSVRNHGLDLKAA 477
            .|..|.|    .|.....||..:.  |.:...|..|..                      :::..
Human   649 HLLGEKT----TCVSAAVSDESVAGDSGVYEAFVKQPS----------------------EMEDV 687

  Fly   478 QLAFDNLRAVENESIRQVIWDNITKELVGSLVCSPADVESMRLYLL------------LPLYHE- 529
            ..:.:::..||...::..:..|...   .|.:...|.:.::..:|:            ||...: 
Human   688 TYSEEDVAIVETAQVQIGLRYNAKS---SSFMVIIAQLRNLHAFLIPHTSKVYFRVAVLPSSTDV 749

  Fly   530 ---FVNSKHYKSLQVPFANAIFKLAENPRKVLNKWLAQTPAEYFEHLVQNFLHVVIHIISFKMGL 591
               |....|..:..:.| |.:|::|          ::||.      |.|..|.|.:         
Human   750 SCLFRTKVHPPTESILF-NDVFRVA----------ISQTA------LQQKTLRVDL--------- 788

  Fly   592 AAASPSAERRQQL----------LPYNTELEI----ILKLMKTLCQINNERHDRLNYQIFYWPDL 642
              .|.|..||::.          ||:::|:..    :|...:..|:.|.|..|.:     :.|:.
Human   789 --CSVSKHRREECLAGTQISLADLPFSSEVFTLWYNLLPSKQMPCKKNEENEDSV-----FQPNQ 846

  Fly   643 SDYADVQQEYVKWIMADTARD 663
            .....:..:.|..::|.|:.:
Human   847 PLVDSIDLDAVSALLARTSAE 867

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Herc4NP_001261249.1 RCC1 6..55 CDD:278826
RCC1 59..110 CDD:278826
RCC1 114..163 CDD:278826
RCC1 167..218 CDD:278826 6/21 (29%)
RCC1 221..270 CDD:278826 11/55 (20%)
RCC1 273..322 CDD:278826 9/54 (17%)
RCC1_2 309..339 CDD:290274 6/29 (21%)
RCC1 327..390 CDD:278826 18/79 (23%)
HECTc 715..1060 CDD:238033
HECTc 739..1059 CDD:214523
WWC2XP_011530571.1 WW 12..41 CDD:278809
WW 59..88 CDD:278809
DUF342 <283..385 CDD:302792
YlqD 351..>428 CDD:287979 4/9 (44%)
C2_Kibra 700..823 CDD:176062 25/153 (16%)
vWFA <1058..>1153 CDD:294047
Phage_Nu1 <1117..1192 CDD:294991
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.