DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Herc4 and HECTD3

DIOPT Version :9

Sequence 1:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster
Sequence 2:NP_078878.3 Gene:HECTD3 / 79654 HGNCID:26117 Length:861 Species:Homo sapiens


Alignment Length:339 Identity:84/339 - (24%)
Similarity:140/339 - (41%) Gaps:56/339 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   726 QDSLREL-QHYSQSDLKKPLKIKFHGEEAEDAGGVRKEFFMLLLKDLL--DPKYGMFKEYEQSRL 787
            :|||.:: :....|....|:.:.|....|....|..:      .:|:.  :|....|.:||    
Human   545 RDSLADMSEELCPSSADTPVPLPFFVRTANQGNGTGE------ARDMYVPNPSCRDFAKYE---- 599

  Fly   788 LWFADLTFETENMYFLIGVLCGLAIYNFTIINLPFPLALFKKLLGKPVDLS-DLRQLSPPEANSM 851
             |              ||.|.|.|:.....:.|..|..::|:|.|:.|..| |.    |...:.:
Human   600 -W--------------IGQLMGAALRGKEFLVLALPGFVWKQLSGEEVSWSKDF----PAVDSVL 645

  Fly   852 QSLLDYQGDDFKEVFDLTF--EIS-RDVFGEAETKCLKPNGNEIAVTLENRQEFVDLYVDFVFNK 913
            ..||:......||.|:..|  |:: ..|..:.:...|.|.|..|.|...:|..|:.|.......:
Human   646 VKLLEVMEGMDKETFEFKFGKELTFTTVLSDQQVVELIPGGAGIVVGYGDRSRFIQLVQKARLEE 710

  Fly   914 SVELHYNAFHKGFMKVCSGRVIHIFQPEELMAVVVGNEDYDWQALQDNCEYREGYTSVDDTIKWF 978
            |.| ...|...|.:||....|:.:...:||...|.|:.:....||:....: |.:...|..:::|
Human   711 SKE-QVAAMQAGLLKVVPQAVLDLLTWQELEKKVCGDPEVTVDALRKLTRF-EDFEPSDSRVQYF 773

  Fly   979 WEVIHDMSEAEKKSFLLFLTGSDRIPIQGMKALKLTIQP------TPDERFLPVAHTCFNLLDLP 1037
            ||.:::.:..::..||.|:||..|:|      .::.|.|      |.|.  ||.:.||.:.|.||
Human   774 WEALNNFTNEDRSRFLRFVTGRSRLP------ARIYIYPDKLGYETTDA--LPESSTCSSTLFLP 830

  Fly  1038 RYKT----KERLKY 1047
            .|.:    :|:|:|
Human   831 HYASAKVCEEKLRY 844

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Herc4NP_001261249.1 RCC1 6..55 CDD:278826
RCC1 59..110 CDD:278826
RCC1 114..163 CDD:278826
RCC1 167..218 CDD:278826
RCC1 221..270 CDD:278826
RCC1 273..322 CDD:278826
RCC1_2 309..339 CDD:290274
RCC1 327..390 CDD:278826
HECTc 715..1060 CDD:238033 84/339 (25%)
HECTc 739..1059 CDD:214523 80/325 (25%)
HECTD3NP_078878.3 APC10-HECTD3 238..371 CDD:176487
HECT 579..845 CDD:366212 76/305 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.