DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Herc4 and Rcbtb1

DIOPT Version :9

Sequence 1:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster
Sequence 2:NP_001347539.1 Gene:Rcbtb1 / 71330 MGIID:1918580 Length:531 Species:Mus musculus


Alignment Length:582 Identity:145/582 - (24%)
Similarity:230/582 - (39%) Gaps:166/582 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LFLTATGKVYACGSNDYSQ---LGHDLPTKRPRMSPFLLIPELQDYVIIQICCGSR--------- 105
            :::|...:|:..|.| ||.   .|.:..|         |:|:.     ::..||.:         
Mouse    35 IYVTDNDEVFVFGLN-YSNCLGTGDNQST---------LVPKK-----LEALCGKKIKSLSYGSG 84

  Fly   106 -HSLALSDWGQVLSWGDNDCGQLGHATDKEIVQLPKVVRQLVTKTVVQIACGNNHSLALTSCGEL 169
             |.|..::.|.|.:||.|...|||:.|..:.:...:|...|:.|.|:::|||::||:||.:.|||
Mouse    85 PHVLLTTEDGVVYAWGHNGYSQLGNGTTNQGIAPVQVCTNLLIKQVIEVACGSHHSMALAADGEL 149

  Fly   170 YSWGSNIYGQLGVNS------PNDLTHCNYPLRLTTLLGIPLAAIACGGNHSFLISKSGAVFGWG 228
            ::||.|..||:|..|      |..:|:|.:..|:..        ||||...|..:..||.|:|||
Mouse   150 FAWGYNNCGQVGSGSTANQPTPRKVTNCLHTKRVVN--------IACGQTSSMAVLDSGEVYGWG 206

  Fly   229 RNNCGQLGLNDETNRSYPTQLKTLRTLGVRFVACGDEFSVFLTNEGGVFTCGAGAYGQLGHGFSS 293
            .|..|||||.:..|:..|.::..|..:.|..:.||...::.||:||.::..||..|||||.|..:
Mouse   207 YNGNGQLGLGNNGNQLTPVRVAALHGMCVNQIVCGYAHTLALTDEGLLYAWGANTYGQLGTGSKN 271

  Fly   294 NEMLPRMVMELMGSTITQVACGNRHTLALVPSRGRVYAFGLGSSGQLGTRSTKSLMLPQV----- 353
            |.:.|..:|......|...||.:.||.|.....|.||.:| ...||       |::||.:     
Mouse   272 NLLSPTQIMVEKERVIEIAACHSTHTSAAKTQGGHVYMWG-QCRGQ-------SVILPHLTHFCC 328

  Fly   354 ---VIGPWVSPSGSALLQSNDSQVSLVIRQIFSGGDQSIVTTTLFVDKVPPEDFRNYNPKSQILT 415
               |...:.:|:.|..|.|                             |..|||         ||
Mouse   329 TDDVFACFGTPAVSWRLLS-----------------------------VEHEDF---------LT 355

  Fly   416 LTAEVTKQCAQCKQGLQSDMDLLSSIELIFRSQACWNGSFLLDHDRHFGCSVRNHGLDLKAAQLA 480
            :.           :.|:.:.|...:.:|.||          :|     |..:..|...||     
Mouse   356 VA-----------ESLKKEFDSPETADLKFR----------ID-----GKYIHVHKAVLK----- 389

  Fly   481 FDNLRAVENESIRQVIWDNITKELVGSLVCSPADVESMRLYLLLPLYHEFVNSKHYKSLQVPFAN 545
               :|.....|:.|..|:...||::        :::...    .|:|..|:...:..::.:|..:
Mouse   390 ---IRCEHFRSMFQSYWNEDMKEVI--------EIDQFS----YPVYRAFLQYLYTDTVDLPPED 439

  Fly   546 AIFKLAENPRKVLNKWLAQTPAEYFEHLVQNFLHVVIHII--------SFKMGLAAASPSAE 599
            ||             .|......|.|:.::....   |||        :|.:..||....||
Mouse   440 AI-------------GLLDLATSYCENRLKRLCQ---HIIKRGITVENAFSLFSAAVRYDAE 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Herc4NP_001261249.1 RCC1 6..55 CDD:278826 0/1 (0%)
RCC1 59..110 CDD:278826 13/63 (21%)
RCC1 114..163 CDD:278826 18/48 (38%)
RCC1 167..218 CDD:278826 19/56 (34%)
RCC1 221..270 CDD:278826 18/48 (38%)
RCC1 273..322 CDD:278826 18/48 (38%)
RCC1_2 309..339 CDD:290274 10/29 (34%)
RCC1 327..390 CDD:278826 14/70 (20%)
HECTc 715..1060 CDD:238033
HECTc 739..1059 CDD:214523
Rcbtb1NP_001347539.1 RCC1 1 40..91 13/65 (20%)
ATS1 43..>316 CDD:227511 95/296 (32%)
RCC1 2 93..145 20/51 (39%)
RCC1 3 147..198 19/58 (33%)
RCC1 4 199..250 19/50 (38%)
RCC1 5 252..302 18/49 (37%)
RCC1 6 304..356 19/97 (20%)
BTB_POZ_RCBTB1_CLLD7 350..466 CDD:349662 33/186 (18%)
BACK_RCBTB1 466..531 CDD:350603 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.