DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Herc4 and Smurf1

DIOPT Version :9

Sequence 1:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster
Sequence 2:XP_006248944.1 Gene:Smurf1 / 690516 RGDID:1594738 Length:757 Species:Rattus norvegicus


Alignment Length:376 Identity:123/376 - (32%)
Similarity:197/376 - (52%) Gaps:51/376 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   717 LNVTRENLVQDSLRELQHYSQSDLKKPLKIKFHGEEAEDAGGVRKEFFMLLLKDLLDPKYGMFKE 781
            :.|:||.:.::|.|::......||||.|.:||.|||..|.|||.:|:..||..::|:|.||:|: 
  Rat   401 IEVSREEIFEESYRQIMKMRPKDLKKRLMVKFRGEEGLDYGGVAREWLYLLCHEMLNPYYGLFQ- 464

  Fly   782 YEQSRLLWFADLTFETENMYFL------------------IGVLCGLAIYNFTIINLPFPLALFK 828
                         :.|:|:|.|                  :|.:.|||:::...||..|.:..:|
  Rat   465 -------------YSTDNIYTLQINPDSSINPDHLSYFHFVGRIMGLAVFHGHYINGGFTVPFYK 516

  Fly   829 KLLGKPVDLSDLRQLSPPEANSMQSLLDYQGDDFKEVFDLTFEISRDVFGEAETKCLKPNGNEIA 893
            :|||||:.||||..:.|....|:..:|:   :|...|.|.||.:..:.||......|||||..:.
  Rat   517 QLLGKPIQLSDLESVDPELHKSLVWILE---NDITPVLDHTFCVEHNAFGRILQHELKPNGRNVP 578

  Fly   894 VTLENRQEFVDLYVDFVFNKSVELHYNAFHKGFMKVCSGRVIHIFQPEELMAVVVGNEDYDWQAL 958
            ||.||::|:|.|||::.|.:.:|..:.|..|||.::....::..|..:||..::.|.:..|....
  Rat   579 VTEENKKEYVRLYVNWRFMRGIEAQFLALQKGFNELIPQHLLKPFDQKELELIIGGLDKIDLNDW 643

  Fly   959 QDNCEYREGYTSVDDT--IKWFWEVIHDMSEAEKKSFLLFLTGSDRIPIQGMKALKLTIQPTPDE 1021
            :.|...:.   .|.|:  ::|||:.:....|..:...|.|:|||.|:|:||.|||:.:.......
  Rat   644 KSNTRLKH---CVADSNIVRWFWQAVETFDEERRARLLQFVTGSTRVPLQGFKALQGSTGAAGPR 705

  Fly  1022 RF-----------LPVAHTCFNLLDLPRYKTKERLKYKLLQAIQQTQGFSL 1061
            .|           ||.||||||.:|:|.|::.|:|..|||.|:::|.||::
  Rat   706 LFTIHLIDANTDNLPKAHTCFNRIDIPPYESYEKLYEKLLTAVEETCGFAV 756

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Herc4NP_001261249.1 RCC1 6..55 CDD:278826
RCC1 59..110 CDD:278826
RCC1 114..163 CDD:278826
RCC1 167..218 CDD:278826
RCC1 221..270 CDD:278826
RCC1 273..322 CDD:278826
RCC1_2 309..339 CDD:290274
RCC1 327..390 CDD:278826
HECTc 715..1060 CDD:238033 122/373 (33%)
HECTc 739..1059 CDD:214523 116/350 (33%)
Smurf1XP_006248944.1 C2_Smurf-like 14..138 CDD:176028
WW 236..267 CDD:197736
WW 307..339 CDD:197736
HECTc 399..754 CDD:238033 121/372 (33%)
HECTc 423..754 CDD:214523 116/350 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.