DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Herc4 and HECW2

DIOPT Version :9

Sequence 1:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster
Sequence 2:XP_006712709.1 Gene:HECW2 / 57520 HGNCID:29853 Length:1579 Species:Homo sapiens


Alignment Length:364 Identity:118/364 - (32%)
Similarity:189/364 - (51%) Gaps:29/364 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   717 LNVTRENLVQDSLRELQHYSQSDLKK-PLKIKFHGEEAEDAGGVRKEFFMLLLKDLLDPKYGMFK 780
            |.:.|::|::|:..::..||:.||:: .|.:.|.|||..|..|..:|||.|:.::|.:|.||:| 
Human  1225 LIIRRDHLLEDAFNQIMGYSRKDLQRNKLYVTFVGEEGLDYSGPSREFFFLVSRELFNPYYGLF- 1288

  Fly   781 EY--------EQSRLLWFADLTFETENMYFLIGVLCGLAIYNFTIINLPFPLALFKKLLGKPVDL 837
            ||        :.|.:..|.|...|   .:...|.:.|||:.:..:::..|....:|.||....||
Human  1289 EYSANDTYTVQISPMSAFVDNHHE---WFRFSGRILGLALIHQYLLDAFFTRPFYKALLRILCDL 1350

  Fly   838 SDLRQLSPPEANSMQSLLDYQGDDFKEVFDLTFEISRDVFGEAETKCLKPNGNEIAVTLENRQEF 902
            |||..|......|:|.:.|   :|..::.||||.::.:|||:...:.|||.|..|.||.:|::|:
Human  1351 SDLEYLDEEFHQSLQWMKD---NDIHDILDLTFTVNEEVFGQITERELKPGGANIPVTEKNKKEY 1412

  Fly   903 VDLYVDFVFNKSVELHYNAFHKGFMKVCSGRVIHIFQPEELMAVVVGNEDYDWQALQDNCEYREG 967
            ::..|.:...:.|.....:..:||.:|...|::.:|...||..|:.|..:.|....::|.|||.|
Human  1413 IERMVKWRIERGVVQQTESLVRGFYEVVDARLVSVFDARELELVIAGTAEIDLSDWRNNTEYRGG 1477

  Fly   968 YTSVDDTIKWFWEVIHDMSEAEKKSFLLFLTGSDRIPIQGMKALKLTIQPTPDERF--------- 1023
            |......|:|||..:...:..::...|.|:||:..||.:|..:|:.:..|   .||         
Human  1478 YHDNHIVIRWFWAAVERFNNEQRLRLLQFVTGTSSIPYEGFASLRGSNGP---RRFCVEKWGKIT 1539

  Fly  1024 -LPVAHTCFNLLDLPRYKTKERLKYKLLQAIQQTQGFSL 1061
             ||.||||||.||||.|.:...|..|||.|:::|..|.|
Human  1540 ALPRAHTCFNRLDLPPYPSFSMLYEKLLTAVEETSTFGL 1578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Herc4NP_001261249.1 RCC1 6..55 CDD:278826
RCC1 59..110 CDD:278826
RCC1 114..163 CDD:278826
RCC1 167..218 CDD:278826
RCC1 221..270 CDD:278826
RCC1 273..322 CDD:278826
RCC1_2 309..339 CDD:290274
RCC1 327..390 CDD:278826
HECTc 715..1060 CDD:238033 116/361 (32%)
HECTc 739..1059 CDD:214523 110/338 (33%)
HECW2XP_006712709.1 HECW_N 45..164 CDD:318711
C2_NEDL1-like 185..321 CDD:176073
NESP55 <471..638 CDD:115071
PHA03169 591..>801 CDD:223003
WW 816..845 CDD:306827
WW 994..1023 CDD:306827
HECTc 1223..1577 CDD:238033 116/361 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.