DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Herc4 and wwtr1

DIOPT Version :9

Sequence 1:	NP_001261249.1	Gene:	Herc4 / 38151	FlyBaseID:	FBgn0035207	Length:	1062	Species:	Drosophila melanogaster
Sequence 2:	NP_001032785.1	Gene:	wwtr1 / 568008	ZFINID:	ZDB-GENE-051101-1	Length:	391	Species:	Danio rerio

Alignment Length:	114	Identity:	30/114 - (26%)
Similarity:	42/114 - (36%)	Gaps:	31/114 - (27%)

- Green bases have known domain annotations that are detailed below.

  Fly   295 EMLPRMVMELMGSTIT--QVACGNRHTLALVPSRGRVYAFGLGSSGQLGTRSTKSLMLPQVVIGP 357
            |.:.|...|||...:.  |:...:.:...:.|:.|....    |:|.:...|..    |.:..||
Zfish   240 ERIQRRQEELMRQEVALRQLPMDSDNLPPVAPAIGSPAM----SAGNMPNNSAD----PFLNSGP 296

  Fly   358 WVSPSGSALLQSNDSQVSLVIRQIFSGGDQSIVTTTLFVDKVPPEDFRN 406
            :.|..     ||.||.:.|        |..||.||        ||||.|
Zfish   297 YHSRE-----QSTDSGLGL--------GCYSIPTT--------PEDFLN 324

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Herc4	NP_001261249.1	RCC1	6..55	CDD:278826
		RCC1	59..110	CDD:278826
		RCC1	114..163	CDD:278826
		RCC1	167..218	CDD:278826
		RCC1	221..270	CDD:278826
		RCC1	273..322	CDD:278826	6/28 (21%)
		RCC1_2	309..339	CDD:290274	4/31 (13%)
		RCC1	327..390	CDD:278826	15/62 (24%)
		HECTc	715..1060	CDD:238033
		HECTc	739..1059	CDD:214523
wwtr1	NP_001032785.1	WW	115..146	CDD:197736
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5021
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900