DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Herc4 and wwc3

DIOPT Version :9

Sequence 1:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster
Sequence 2:NP_001103940.1 Gene:wwc3 / 566492 ZFINID:ZDB-GENE-070209-229 Length:1148 Species:Danio rerio


Alignment Length:363 Identity:70/363 - (19%)
Similarity:118/363 - (32%) Gaps:124/363 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   407 YNP---KSQILTLTAEVTK---QCAQCKQGLQ-SDMDLLSSIELIFRSQACWNGSFLLDHDRHFG 464
            |:|   |::|......:::   :.||.:|.|| .:|.:.:..|:                ||...
Zfish   164 YDPDQIKAEIACRRERLSRLKQELAQMRQELQYKEMGVETLQEI----------------DRKMS 212

  Fly   465 CSVRNHGLDLKAAQLAFDNLRAVE-----NESIRQVIWDNITKELVGSLVCSPADVESMRLYLLL 524
            .|..|:.||  .||..|..||:::     .|..||        :|:.||.               
Zfish   213 SSQTNYKLD--EAQAIFSELRSIKKAISTGEKERQ--------DLIQSLA--------------- 252

  Fly   525 PLYHEFVNSKHYKSLQVPFANAIFKLAENPRKVLNKWLAQ--TPAEYFEHLVQNFLHVVIHIISF 587
                         .|.:.|.::|.::..|...:.:....|  |.|.....|:..|          
Zfish   253 -------------KLTLNFCDSINEVTNNAESLADSCSVQQYTDAGCQTDLMGEF---------- 294

  Fly   588 KMGLAAASPSAERRQQLLPYNTELEIILKLMKTLCQINNERHDRLNYQIFYWPDLSDYADVQQEY 652
              |...:|..|:|.:....|....:.:..:...|.|:::|.          |   |..|:..:: 
Zfish   295 --GSQESSLLADRVKLSWQYEEAKKKMSSIQHQLAQLDSES----------W---SGRAEADRD- 343

  Fly   653 VKWIMADTARDFNICNYSFIF---DQSAKTALLQ--------ADQALQMHSAMANAATMAFSFFN 706
              |......|:..........   .|.:...|||        .|:..:.|||.:..|        
Zfish   344 --WDCLQLLREKETLLQELTLLSQQQHSSDTLLQLQEEKRRLQDEVQRAHSAQSQGA-------- 398

  Fly   707 YGMPISQFIVLNVTRENLVQDSLRE---LQHYSQSDLK 741
                 :|.|:|...| |::...|.|   :..|..|.||
Zfish   399 -----NQRILLQEKR-NVLMRQLEEATRITTYLHSQLK 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Herc4NP_001261249.1 RCC1 6..55 CDD:278826
RCC1 59..110 CDD:278826
RCC1 114..163 CDD:278826
RCC1 167..218 CDD:278826
RCC1 221..270 CDD:278826
RCC1 273..322 CDD:278826
RCC1_2 309..339 CDD:290274
RCC1 327..390 CDD:278826
HECTc 715..1060 CDD:238033 10/30 (33%)
HECTc 739..1059 CDD:214523 2/3 (67%)
wwc3NP_001103940.1 WW 17..46 CDD:278809
WW 64..93 CDD:278809
C2_Kibra 677..800 CDD:176062
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.