DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Herc4 and sergef

DIOPT Version :9

Sequence 1:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster
Sequence 2:XP_021329502.1 Gene:sergef / 565673 ZFINID:ZDB-GENE-061220-11 Length:397 Species:Danio rerio


Alignment Length:367 Identity:111/367 - (30%)
Similarity:171/367 - (46%) Gaps:33/367 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LYCWGSTSHGQLGLGGIEDEQILTPSQI-PWTPDTAVQQVACGHRHTLFLTATGKVYACGSNDYS 70
            ||.||:.|:||||.|..||:  ..|.:: ....:..::.|..|..|:..::.:|::..||.|...
Zfish    13 LYTWGANSYGQLGQGNAEDQ--AEPRRVESGLQEEQIRAVTGGGGHSALISDSGELLVCGQNHKG 75

  Fly    71 QLG--HDLPTKRPRMSPFLLIPELQDYVIIQICCGSRHSLALSDWGQVLSWGDNDCGQLGHATDK 133
            |||  |.|.....:..|......:|     |:.||...::.|:..|.||:.|.|..||||.:.:|
Zfish    76 QLGLCHTLEIMTFQTCPLPGFGRVQ-----QVSCGWDFTIILTGDGLVLACGSNAFGQLGGSAEK 135

  Fly   134 EIVQLPKVVRQLVTKTVVQIACGNNHSLALTSCGELYSWGSNI--YGQLGVNS---PNDLTHCNY 193
            .....|.:::.. .:.|..:|.|..|:||.|:.|.:|.||:.:  :.:..:|.   |:.|: ...
Zfish   136 THSAEPLLLKSF-HEPVTSVAAGLRHALASTASGCVYQWGTGLSSHAKRMLNPQPVPSHLS-SKE 198

  Fly   194 PLRLTTLLGIPLAAIACGGNHSFLISKSGAVFGWGRNNCGQLGLNDETNRSYPTQL--KTLRTLG 256
            |..:.....:....:..|..|...::.:|.||.||.|..||| ::.......|..|  ..|:...
Zfish   199 PCLVPGFAHVTTQKVIAGSAHCACLTVNGDVFLWGSNKHGQL-ISGSLFLPLPVALDRSMLQDER 262

  Fly   257 VRFVACGDEFSVFLTNEGGVFTCGAGAYGQLG---HGF---SSNEMLPRMVME---LMGSTITQV 312
            |..|..|....|..|..|.|||.|...|||||   |..   |.:|.|.|..:|   |.|:  ||:
Zfish   263 VSDVHSGWTHLVAQTESGRVFTWGRSNYGQLGQTNHSMEKQSCDERLVRSPVEVKALFGA--TQI 325

  Fly   313 ACGNRHTLALVPSRGRVYAFGLGSSGQLGTRSTKSLMLPQVV 354
            :||:.|.||:|  .|||:::|....|..|..|.:.:..||.:
Zfish   326 SCGSEHNLAVV--GGRVFSWGWNEHGMCGDGSLQDITQPQPI 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Herc4NP_001261249.1 RCC1 6..55 CDD:278826 16/48 (33%)
RCC1 59..110 CDD:278826 14/52 (27%)
RCC1 114..163 CDD:278826 16/48 (33%)
RCC1 167..218 CDD:278826 10/55 (18%)
RCC1 221..270 CDD:278826 16/50 (32%)
RCC1 273..322 CDD:278826 24/57 (42%)
RCC1_2 309..339 CDD:290274 12/29 (41%)
RCC1 327..390 CDD:278826 9/28 (32%)
HECTc 715..1060 CDD:238033
HECTc 739..1059 CDD:214523
sergefXP_021329502.1 RCC1 13..387 CDD:332518 111/367 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.